Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4390294..4391075 | Replicon | chromosome |
| Accession | NZ_CP121295 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 998 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A744N2R8 |
| Locus tag | P1837_RS21490 | Protein ID | WP_061383248.1 |
| Coordinates | 4390294..4390785 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | P1837_RS21495 | Protein ID | WP_001110452.1 |
| Coordinates | 4390782..4391075 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1837_RS21455 (4385703) | 4385703..4386050 | + | 348 | WP_076737629.1 | divalent cation tolerance protein CutA | - |
| P1837_RS21460 (4386026) | 4386026..4387729 | + | 1704 | WP_076737628.1 | protein-disulfide reductase DsbD | - |
| P1837_RS21465 (4387766) | 4387766..4388341 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| P1837_RS21475 (4388613) | 4388613..4388687 | - | 75 | Protein_4179 | helix-turn-helix domain-containing protein | - |
| P1837_RS21480 (4389067) | 4389067..4389143 | + | 77 | Protein_4180 | porin family protein | - |
| P1837_RS21485 (4389243) | 4389243..4389995 | + | 753 | WP_064042932.1 | non-specific acid phosphatase | - |
| P1837_RS21490 (4390294) | 4390294..4390785 | - | 492 | WP_061383248.1 | GNAT family N-acetyltransferase | Toxin |
| P1837_RS21495 (4390782) | 4390782..4391075 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| P1837_RS21500 (4391392) | 4391392..4391614 | + | 223 | Protein_4184 | hypothetical protein | - |
| P1837_RS21505 (4391878) | 4391878..4392753 | + | 876 | WP_278208502.1 | AraC family transcriptional regulator | - |
| P1837_RS21510 (4392750) | 4392750..4393037 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| P1837_RS21515 (4393177) | 4393177..4393551 | + | 375 | WP_232234247.1 | Ig-like domain-containing protein | - |
| P1837_RS21520 (4393846) | 4393846..4394751 | - | 906 | WP_064042929.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17649.45 Da Isoelectric Point: 7.7297
>T276223 WP_061383248.1 NZ_CP121295:c4390785-4390294 [Salmonella enterica subsp. enterica]
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A744N2R8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |