Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 4283515..4284158 | Replicon | chromosome |
| Accession | NZ_CP121295 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 998 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B5F3H8 |
| Locus tag | P1837_RS20925 | Protein ID | WP_000048134.1 |
| Coordinates | 4283742..4284158 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B5F3H9 |
| Locus tag | P1837_RS20920 | Protein ID | WP_001261294.1 |
| Coordinates | 4283515..4283745 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1837_RS20910 (4280529) | 4280529..4282667 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P1837_RS20915 (4282884) | 4282884..4283348 | + | 465 | WP_076737652.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P1837_RS20920 (4283515) | 4283515..4283745 | + | 231 | WP_001261294.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P1837_RS20925 (4283742) | 4283742..4284158 | + | 417 | WP_000048134.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P1837_RS20930 (4284219) | 4284219..4286132 | - | 1914 | WP_149866235.1 | BglG family transcription antiterminator | - |
| P1837_RS20935 (4286149) | 4286149..4286889 | - | 741 | WP_048591337.1 | KDGP aldolase family protein | - |
| P1837_RS20940 (4286886) | 4286886..4288004 | - | 1119 | WP_076737650.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| P1837_RS20945 (4287988) | 4287988..4289121 | - | 1134 | WP_076737649.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15135.50 Da Isoelectric Point: 8.1381
>T276222 WP_000048134.1 NZ_CP121295:4283742-4284158 [Salmonella enterica subsp. enterica]
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
MSKTYMLDTCICSFIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGCTGKKASPRHAQLVDAFCSRLDAVLAWDRA
AVDATTEIRAVLAAAGTPIGSNDAAIAGHAIASGAILVTNNVREFERVPGLQYEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2T8L749 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V4SIC2 |