Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3635913..3636533 | Replicon | chromosome |
| Accession | NZ_CP121295 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 998 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | P1837_RS17915 | Protein ID | WP_001280991.1 |
| Coordinates | 3636315..3636533 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | P1837_RS17910 | Protein ID | WP_000344807.1 |
| Coordinates | 3635913..3636287 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1837_RS17900 (3631052) | 3631052..3632245 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| P1837_RS17905 (3632268) | 3632268..3635417 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| P1837_RS17910 (3635913) | 3635913..3636287 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| P1837_RS17915 (3636315) | 3636315..3636533 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| P1837_RS17920 (3636712) | 3636712..3637263 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| P1837_RS17925 (3637379) | 3637379..3637849 | + | 471 | WP_080170962.1 | YlaC family protein | - |
| P1837_RS17930 (3637905) | 3637905..3638045 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| P1837_RS17935 (3638051) | 3638051..3638311 | - | 261 | WP_000801421.1 | type B 50S ribosomal protein L31 | - |
| P1837_RS17940 (3638536) | 3638536..3640086 | + | 1551 | WP_023210786.1 | EAL domain-containing protein | - |
| P1837_RS17950 (3640317) | 3640317..3640706 | + | 390 | WP_278208425.1 | MGMT family protein | - |
| P1837_RS17955 (3640739) | 3640739..3641308 | - | 570 | WP_000779801.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T276220 WP_001280991.1 NZ_CP121295:3636315-3636533 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT276220 WP_000344807.1 NZ_CP121295:3635913-3636287 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|