Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1250016..1250830 | Replicon | chromosome |
Accession | NZ_CP121295 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 998 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | P1837_RS05935 | Protein ID | WP_000971655.1 |
Coordinates | 1250016..1250543 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | P1837_RS05940 | Protein ID | WP_000855694.1 |
Coordinates | 1250540..1250830 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1837_RS05915 (1245220) | 1245220..1247787 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
P1837_RS05920 (1247946) | 1247946..1248466 | + | 521 | Protein_1146 | cytoplasmic protein | - |
P1837_RS05925 (1248637) | 1248637..1249293 | - | 657 | WP_000420459.1 | protein-serine/threonine phosphatase | - |
P1837_RS05930 (1249520) | 1249520..1249943 | + | 424 | Protein_1148 | transposase | - |
P1837_RS05935 (1250016) | 1250016..1250543 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
P1837_RS05940 (1250540) | 1250540..1250830 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
P1837_RS05945 (1251099) | 1251099..1251299 | - | 201 | Protein_1151 | IS3 family transposase | - |
P1837_RS05950 (1251540) | 1251540..1251866 | + | 327 | WP_076737359.1 | hypothetical protein | - |
P1837_RS05955 (1252139) | 1252139..1252486 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
P1837_RS05960 (1252471) | 1252471..1252920 | - | 450 | WP_000381613.1 | hypothetical protein | - |
P1837_RS05965 (1253352) | 1253352..1253795 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
P1837_RS05970 (1254251) | 1254251..1254901 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1249749..1249943 | 194 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T276215 WP_000971655.1 NZ_CP121295:c1250543-1250016 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |