Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 3842456..3842981 | Replicon | chromosome |
Accession | NZ_CP121294 | ||
Organism | Escherichia coli O155:H21 strain NWU_1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | P9N54_RS18555 | Protein ID | WP_029305600.1 |
Coordinates | 3842456..3842761 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | P9N54_RS18560 | Protein ID | WP_000813634.1 |
Coordinates | 3842763..3842981 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9N54_RS18540 (3839033) | 3839033..3840004 | - | 972 | WP_000817031.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
P9N54_RS18545 (3840004) | 3840004..3841170 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
P9N54_RS18550 (3841769) | 3841769..3842455 | - | 687 | WP_072301646.1 | tyrosine-type recombinase/integrase | - |
P9N54_RS18555 (3842456) | 3842456..3842761 | - | 306 | WP_029305600.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
P9N54_RS18560 (3842763) | 3842763..3842981 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
P9N54_RS18565 (3843561) | 3843561..3844649 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
P9N54_RS18570 (3844651) | 3844651..3846876 | + | 2226 | WP_040073691.1 | P-loop NTPase fold protein | - |
P9N54_RS18575 (3846926) | 3846926..3847825 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 3807814..3853704 | 45890 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11716.55 Da Isoelectric Point: 6.4674
>T276206 WP_029305600.1 NZ_CP121294:c3842761-3842456 [Escherichia coli O155:H21]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVPVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVPVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|