Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3798670..3799295 | Replicon | chromosome |
Accession | NZ_CP121294 | ||
Organism | Escherichia coli O155:H21 strain NWU_1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P9N54_RS18265 | Protein ID | WP_000911317.1 |
Coordinates | 3798897..3799295 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | P9N54_RS18260 | Protein ID | WP_000450532.1 |
Coordinates | 3798670..3798897 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9N54_RS18260 (3798670) | 3798670..3798897 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P9N54_RS18265 (3798897) | 3798897..3799295 | + | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P9N54_RS18270 (3799304) | 3799304..3801457 | - | 2154 | WP_023568632.1 | type IV conjugative transfer system coupling protein TraD | - |
P9N54_RS18275 (3801709) | 3801709..3802440 | - | 732 | WP_000850430.1 | conjugal transfer complement resistance protein TraT | - |
P9N54_RS18280 (3802472) | 3802472..3802969 | - | 498 | WP_000605859.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T276202 WP_000911317.1 NZ_CP121294:3798897-3799295 [Escherichia coli O155:H21]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|