Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 2761437..2762237 | Replicon | chromosome |
| Accession | NZ_CP121294 | ||
| Organism | Escherichia coli O155:H21 strain NWU_1 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | P9N54_RS13500 | Protein ID | WP_136721175.1 |
| Coordinates | 2761437..2761964 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | F4NNI1 |
| Locus tag | P9N54_RS13505 | Protein ID | WP_001277108.1 |
| Coordinates | 2761971..2762237 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9N54_RS13475 (2756512) | 2756512..2757279 | - | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| P9N54_RS13480 (2757276) | 2757276..2758553 | - | 1278 | WP_000803771.1 | branched chain amino acid ABC transporter permease LivM | - |
| P9N54_RS13485 (2758550) | 2758550..2759476 | - | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| P9N54_RS13490 (2759524) | 2759524..2760633 | - | 1110 | WP_000827696.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| P9N54_RS13495 (2761057) | 2761057..2761440 | + | 384 | WP_000778795.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| P9N54_RS13500 (2761437) | 2761437..2761964 | - | 528 | WP_136721175.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| P9N54_RS13505 (2761971) | 2761971..2762237 | - | 267 | WP_001277108.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| P9N54_RS13510 (2762387) | 2762387..2763490 | - | 1104 | WP_001021996.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| P9N54_RS13515 (2763761) | 2763761..2764615 | - | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| P9N54_RS13520 (2764860) | 2764860..2765918 | - | 1059 | WP_001042003.1 | permease-like cell division protein FtsX | - |
| P9N54_RS13525 (2765911) | 2765911..2766579 | - | 669 | WP_000617723.1 | cell division ATP-binding protein FtsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19740.77 Da Isoelectric Point: 7.7438
>T276199 WP_136721175.1 NZ_CP121294:c2761964-2761437 [Escherichia coli O155:H21]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENEYAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLCGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNKKAHTFYQSLGFIPLVGENEYAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|