Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2501611..2502236 | Replicon | chromosome |
| Accession | NZ_CP121294 | ||
| Organism | Escherichia coli O155:H21 strain NWU_1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P9N54_RS12280 | Protein ID | WP_000911330.1 |
| Coordinates | 2501611..2502009 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | P9N54_RS12285 | Protein ID | WP_000450524.1 |
| Coordinates | 2502009..2502236 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9N54_RS12260 (2497489) | 2497489..2497689 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| P9N54_RS12265 (2497799) | 2497799..2498497 | - | 699 | WP_000679823.1 | esterase | - |
| P9N54_RS12270 (2498571) | 2498571..2500586 | - | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| P9N54_RS12275 (2500601) | 2500601..2501464 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| P9N54_RS12280 (2501611) | 2501611..2502009 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P9N54_RS12285 (2502009) | 2502009..2502236 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| P9N54_RS12290 (2502390) | 2502390..2503103 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| P9N54_RS12295 (2503316) | 2503316..2504350 | - | 1035 | WP_136721100.1 | outer membrane protein assembly factor BamC | - |
| P9N54_RS12300 (2504367) | 2504367..2505245 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| P9N54_RS12305 (2505391) | 2505391..2505963 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| P9N54_RS12310 (2505963) | 2505963..2506433 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T276198 WP_000911330.1 NZ_CP121294:c2502009-2501611 [Escherichia coli O155:H21]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|