Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1482854..1483691 | Replicon | chromosome |
Accession | NZ_CP121294 | ||
Organism | Escherichia coli O155:H21 strain NWU_1 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | P9N54_RS07335 | Protein ID | WP_000227784.1 |
Coordinates | 1482854..1483396 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | P9N54_RS07340 | Protein ID | WP_001297137.1 |
Coordinates | 1483380..1483691 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9N54_RS07315 (1478393) | 1478393..1479304 | - | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
P9N54_RS07320 (1479472) | 1479472..1479963 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
P9N54_RS07325 (1480091) | 1480091..1481455 | - | 1365 | WP_001000978.1 | MFS transporter | - |
P9N54_RS07330 (1481863) | 1481863..1482798 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
P9N54_RS07335 (1482854) | 1482854..1483396 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
P9N54_RS07340 (1483380) | 1483380..1483691 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
P9N54_RS07345 (1483876) | 1483876..1484766 | - | 891 | WP_000971336.1 | heme o synthase | - |
P9N54_RS07350 (1484778) | 1484778..1485107 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
P9N54_RS07355 (1485107) | 1485107..1485721 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
P9N54_RS07360 (1485711) | 1485711..1487702 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
P9N54_RS07365 (1487724) | 1487724..1488671 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T276193 WP_000227784.1 NZ_CP121294:c1483396-1482854 [Escherichia coli O155:H21]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|