Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 1270377..1271015 | Replicon | chromosome |
Accession | NZ_CP121294 | ||
Organism | Escherichia coli O155:H21 strain NWU_1 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | P9N54_RS06355 | Protein ID | WP_000813794.1 |
Coordinates | 1270377..1270553 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P9N54_RS06360 | Protein ID | WP_136721302.1 |
Coordinates | 1270599..1271015 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9N54_RS06335 (1265996) | 1265996..1267171 | - | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
P9N54_RS06340 (1267263) | 1267263..1267799 | + | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
P9N54_RS06345 (1267872) | 1267872..1269833 | + | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
P9N54_RS06350 (1269925) | 1269925..1270155 | - | 231 | WP_000494244.1 | YncJ family protein | - |
P9N54_RS06355 (1270377) | 1270377..1270553 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
P9N54_RS06360 (1270599) | 1270599..1271015 | + | 417 | WP_136721302.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
P9N54_RS06365 (1271094) | 1271094..1272500 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
P9N54_RS06370 (1272745) | 1272745..1273890 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
P9N54_RS06375 (1273908) | 1273908..1274921 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
P9N54_RS06380 (1274922) | 1274922..1275863 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | vgrG/tssI / vgrG/tssI | 1264691..1317658 | 52967 | |
- | flank | IS/Tn | - | - | 1264691..1265956 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T276192 WP_000813794.1 NZ_CP121294:1270377-1270553 [Escherichia coli O155:H21]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15245.69 Da Isoelectric Point: 5.1738
>AT276192 WP_136721302.1 NZ_CP121294:1270599-1271015 [Escherichia coli O155:H21]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAKAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAKAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|