Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relB-yefM/YoeB-YefM |
| Location | 3374582..3375093 | Replicon | chromosome |
| Accession | NZ_CP121274 | ||
| Organism | Microbacterium proteolyticum strain ustc | ||
Toxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | P8R59_RS16950 | Protein ID | WP_278102020.1 |
| Coordinates | 3374827..3375093 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | yefM | Uniprot ID | - |
| Locus tag | P8R59_RS16945 | Protein ID | WP_077051824.1 |
| Coordinates | 3374582..3374830 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8R59_RS16920 | 3369851..3371272 | - | 1422 | WP_278102015.1 | histidine kinase | - |
| P8R59_RS16925 | 3371273..3371719 | - | 447 | WP_278102016.1 | hypothetical protein | - |
| P8R59_RS16930 | 3371898..3372752 | + | 855 | WP_278102017.1 | hypothetical protein | - |
| P8R59_RS16935 | 3372807..3374120 | - | 1314 | WP_278102018.1 | MFS transporter | - |
| P8R59_RS16940 | 3374194..3374475 | - | 282 | WP_278102019.1 | hypothetical protein | - |
| P8R59_RS16945 | 3374582..3374830 | + | 249 | WP_077051824.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| P8R59_RS16950 | 3374827..3375093 | + | 267 | WP_278102020.1 | Txe/YoeB family addiction module toxin | Toxin |
| P8R59_RS16955 | 3375124..3376197 | - | 1074 | WP_278102021.1 | redox-regulated ATPase YchF | - |
| P8R59_RS16960 | 3376237..3376986 | - | 750 | WP_278102022.1 | class I SAM-dependent methyltransferase | - |
| P8R59_RS16965 | 3377161..3377757 | + | 597 | WP_278102023.1 | 3'-5' exonuclease | - |
| P8R59_RS16970 | 3377808..3379130 | + | 1323 | WP_278102024.1 | DNA recombination protein RmuC | - |
| P8R59_RS16975 | 3379141..3379350 | - | 210 | WP_077051830.1 | UDP-N-acetylmuramyl pentapeptide phosphotransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10342.64 Da Isoelectric Point: 6.2173
>T276177 WP_278102020.1 NZ_CP121274:3374827-3375093 [Microbacterium proteolyticum]
VSQLSLAWTAEGWEDYLYWQTQDRKTLRRINQLIADMLRDDPFEGIGKPEPLRHALAGALSRRIDEANRLVYITDDTHVT
VLQARYHY
VSQLSLAWTAEGWEDYLYWQTQDRKTLRRINQLIADMLRDDPFEGIGKPEPLRHALAGALSRRIDEANRLVYITDDTHVT
VLQARYHY
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|