Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 89163..89716 | Replicon | chromosome |
Accession | NZ_CP121274 | ||
Organism | Microbacterium proteolyticum strain ustc |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P8R59_RS01195 | Protein ID | WP_278102367.1 |
Coordinates | 89163..89435 (-) | Length | 91 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P8R59_RS01200 | Protein ID | WP_278102368.1 |
Coordinates | 89432..89716 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8R59_RS01175 | 84172..85218 | + | 1047 | WP_077052190.1 | MoxR family ATPase | - |
P8R59_RS01180 | 85226..86473 | + | 1248 | WP_278102364.1 | DUF58 domain-containing protein | - |
P8R59_RS01185 | 86460..88766 | + | 2307 | WP_278102365.1 | DUF3488 and transglutaminase-like domain-containing protein | - |
P8R59_RS01190 | 88780..89088 | - | 309 | WP_278102366.1 | hypothetical protein | - |
P8R59_RS01195 | 89163..89435 | - | 273 | WP_278102367.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8R59_RS01200 | 89432..89716 | - | 285 | WP_278102368.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P8R59_RS01210 | 89895..90863 | - | 969 | WP_278102369.1 | acetamidase/formamidase family protein | - |
P8R59_RS01215 | 90860..92284 | - | 1425 | WP_278102370.1 | APC family permease | - |
P8R59_RS01220 | 92340..93230 | - | 891 | WP_278102371.1 | proline iminopeptidase-family hydrolase | - |
P8R59_RS01225 | 93312..94052 | + | 741 | WP_278102372.1 | GntR family transcriptional regulator | - |
P8R59_RS01230 | 94055..94630 | - | 576 | WP_278102373.1 | GNAT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 91 a.a. Molecular weight: 10465.13 Da Isoelectric Point: 10.3955
>T276176 WP_278102367.1 NZ_CP121274:c89435-89163 [Microbacterium proteolyticum]
MTDGYEVVFTRTARRALAQELPEKIAAAAFEFILGALRENPRRVGKPLREPLAPLYSARRGEYRVLYRIVDERLVIEVVS
VVHRRDAYHR
MTDGYEVVFTRTARRALAQELPEKIAAAAFEFILGALRENPRRVGKPLREPLAPLYSARRGEYRVLYRIVDERLVIEVVS
VVHRRDAYHR
Download Length: 273 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|