Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-Phd |
Location | 2865361..2865923 | Replicon | chromosome |
Accession | NZ_CP121270 | ||
Organism | Gordonia hongkongensis strain RL-LY01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A6G7W718 |
Locus tag | P9A14_RS13090 | Protein ID | WP_055477308.1 |
Coordinates | 2865361..2865651 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A6G7W6R5 |
Locus tag | P9A14_RS13095 | Protein ID | WP_055477309.1 |
Coordinates | 2865648..2865923 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9A14_RS13070 (P9A14_13070) | 2861312..2863372 | + | 2061 | WP_068970440.1 | DEAD/DEAH box helicase family protein | - |
P9A14_RS13075 (P9A14_13075) | 2863407..2863646 | + | 240 | WP_055477305.1 | hypothetical protein | - |
P9A14_RS13080 (P9A14_13080) | 2864235..2864468 | + | 234 | WP_055477307.1 | hypothetical protein | - |
P9A14_RS13085 (P9A14_13085) | 2865136..2865342 | + | 207 | WP_055477311.1 | hypothetical protein | - |
P9A14_RS13090 (P9A14_13090) | 2865361..2865651 | - | 291 | WP_055477308.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9A14_RS13095 (P9A14_13095) | 2865648..2865923 | - | 276 | WP_055477309.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P9A14_RS13100 (P9A14_13100) | 2866043..2866519 | - | 477 | WP_254661286.1 | TetR family transcriptional regulator | - |
P9A14_RS13105 (P9A14_13105) | 2866532..2866663 | - | 132 | Protein_2581 | hypothetical protein | - |
P9A14_RS13110 (P9A14_13110) | 2866660..2867187 | - | 528 | WP_065631669.1 | GNAT family N-acetyltransferase | - |
P9A14_RS13115 (P9A14_13115) | 2867595..2868356 | + | 762 | WP_068970441.1 | hypothetical protein | - |
P9A14_RS13120 (P9A14_13120) | 2868411..2868716 | + | 306 | WP_068970442.1 | hypothetical protein | - |
P9A14_RS13125 (P9A14_13125) | 2868768..2869148 | - | 381 | WP_065631666.1 | SRPBCC family protein | - |
P9A14_RS13130 (P9A14_13130) | 2869297..2870202 | - | 906 | WP_065631665.1 | RNA polymerase sigma-70 factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10938.40 Da Isoelectric Point: 9.7360
>T276174 WP_055477308.1 NZ_CP121270:c2865651-2865361 [Gordonia hongkongensis]
MSDAPTDSSAPYRVEVASPARRDLQRLPSRIVHAVIEFISGPLAENPHRLSKPLRDDLADLHSARRGDYRILLRIDDPNH
TIVIVRIDHRAHAYRT
MSDAPTDSSAPYRVEVASPARRDLQRLPSRIVHAVIEFISGPLAENPHRLSKPLRDDLADLHSARRGDYRILLRIDDPNH
TIVIVRIDHRAHAYRT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6G7W718 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6G7W6R5 |