Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-PHD |
| Location | 1207956..1208629 | Replicon | chromosome |
| Accession | NZ_CP121270 | ||
| Organism | Gordonia hongkongensis strain RL-LY01 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P9A14_RS05510 | Protein ID | WP_137810536.1 |
| Coordinates | 1208225..1208629 (+) | Length | 135 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | P9A14_RS05505 | Protein ID | WP_137810537.1 |
| Coordinates | 1207956..1208228 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9A14_RS05490 (P9A14_05490) | 1203380..1204363 | + | 984 | WP_165630431.1 | LLM class F420-dependent oxidoreductase | - |
| P9A14_RS05495 (P9A14_05495) | 1204880..1206046 | - | 1167 | WP_137810539.1 | pyridoxal phosphate-dependent aminotransferase | - |
| P9A14_RS05500 (P9A14_05500) | 1206144..1207823 | + | 1680 | WP_137810538.1 | serine/threonine-protein kinase | - |
| P9A14_RS05505 (P9A14_05505) | 1207956..1208228 | + | 273 | WP_137810537.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| P9A14_RS05510 (P9A14_05510) | 1208225..1208629 | + | 405 | WP_137810536.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P9A14_RS05515 (P9A14_05515) | 1208631..1210307 | - | 1677 | WP_065631752.1 | DEAD/DEAH box helicase | - |
| P9A14_RS05520 (P9A14_05520) | 1210374..1211303 | - | 930 | WP_137810535.1 | oxygenase MpaB family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 135 a.a. Molecular weight: 14167.42 Da Isoelectric Point: 4.6533
>T276173 WP_137810536.1 NZ_CP121270:1208225-1208629 [Gordonia hongkongensis]
MIYLDTSAMVKLVVREAETAPLIEWFALRPGVPTVTSALGRVELMRTALRDGSPGLHERARDLLDALDVIPLSAAVIDIA
ESIGPSSLRSLDALHLASATVIRAEMTAFVAYDQRLTAGASALGYPVVAPGAEL
MIYLDTSAMVKLVVREAETAPLIEWFALRPGVPTVTSALGRVELMRTALRDGSPGLHERARDLLDALDVIPLSAAVIDIA
ESIGPSSLRSLDALHLASATVIRAEMTAFVAYDQRLTAGASALGYPVVAPGAEL
Download Length: 405 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|