Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4589698..4590314 | Replicon | chromosome |
Accession | NZ_CP121269 | ||
Organism | Enterobacter hormaechei subsp. xiangfangensis strain F81Y |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P9J39_RS21825 | Protein ID | WP_017382676.1 |
Coordinates | 4589698..4590069 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | P9J39_RS21830 | Protein ID | WP_015569912.1 |
Coordinates | 4590072..4590314 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9J39_RS21810 (P9J39_21810) | 4587198..4588100 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
P9J39_RS21815 (P9J39_21815) | 4588097..4588732 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
P9J39_RS21820 (P9J39_21820) | 4588729..4589658 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
P9J39_RS21825 (P9J39_21825) | 4589698..4590069 | - | 372 | WP_017382676.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P9J39_RS21830 (P9J39_21830) | 4590072..4590314 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
P9J39_RS21835 (P9J39_21835) | 4590513..4591433 | + | 921 | WP_063158447.1 | alpha/beta hydrolase | - |
P9J39_RS21840 (P9J39_21840) | 4591442..4592383 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
P9J39_RS21845 (P9J39_21845) | 4592428..4592865 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
P9J39_RS21850 (P9J39_21850) | 4592862..4593743 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
P9J39_RS21855 (P9J39_21855) | 4593737..4594336 | - | 600 | WP_017694048.1 | glucose-1-phosphatase | - |
P9J39_RS21860 (P9J39_21860) | 4594455..4595255 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13737.88 Da Isoelectric Point: 6.4882
>T276172 WP_017382676.1 NZ_CP121269:c4590069-4589698 [Enterobacter hormaechei subsp. xiangfangensis]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|