Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2301805..2302544 | Replicon | chromosome |
Accession | NZ_CP121269 | ||
Organism | Enterobacter hormaechei subsp. xiangfangensis strain F81Y |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | P9J39_RS10950 | Protein ID | WP_278110266.1 |
Coordinates | 2301805..2302290 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | P9J39_RS10955 | Protein ID | WP_003857131.1 |
Coordinates | 2302278..2302544 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9J39_RS10920 (P9J39_10920) | 2297303..2297917 | + | 615 | WP_080337332.1 | NUDIX hydrolase | - |
P9J39_RS10925 (P9J39_10925) | 2298101..2298736 | - | 636 | WP_015570517.1 | DUF421 domain-containing protein | - |
P9J39_RS10930 (P9J39_10930) | 2298746..2299192 | - | 447 | WP_014069654.1 | DUF3290 domain-containing protein | - |
P9J39_RS10935 (P9J39_10935) | 2299621..2299949 | - | 329 | Protein_2130 | ISNCY family transposase | - |
P9J39_RS10940 (P9J39_10940) | 2300204..2301169 | + | 966 | WP_032648329.1 | hypothetical protein | - |
P9J39_RS10945 (P9J39_10945) | 2301185..2301754 | + | 570 | WP_032648331.1 | hypothetical protein | - |
P9J39_RS10950 (P9J39_10950) | 2301805..2302290 | - | 486 | WP_278110266.1 | GNAT family N-acetyltransferase | Toxin |
P9J39_RS10955 (P9J39_10955) | 2302278..2302544 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
P9J39_RS10960 (P9J39_10960) | 2302608..2303537 | - | 930 | WP_252011907.1 | LysR family transcriptional regulator | - |
P9J39_RS10965 (P9J39_10965) | 2303667..2305055 | + | 1389 | WP_278110276.1 | MFS transporter | - |
P9J39_RS10970 (P9J39_10970) | 2305077..2306072 | - | 996 | WP_017693414.1 | DUF2891 domain-containing protein | - |
P9J39_RS10975 (P9J39_10975) | 2306082..2307068 | - | 987 | WP_017693413.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T276164 WP_278110266.1 NZ_CP121269:c2302290-2301805 [Enterobacter hormaechei subsp. xiangfangensis]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKTFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARAFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKTFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|