Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1874162..1874772 | Replicon | chromosome |
| Accession | NZ_CP121269 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain F81Y | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | D2TUP9 |
| Locus tag | P9J39_RS08920 | Protein ID | WP_012906750.1 |
| Coordinates | 1874593..1874772 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P9J39_RS08915 | Protein ID | WP_045897211.1 |
| Coordinates | 1874162..1874572 (-) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9J39_RS08895 (P9J39_08895) | 1869971..1870522 | + | 552 | WP_045345258.1 | phage tail protein I | - |
| P9J39_RS08900 (P9J39_08900) | 1870525..1873086 | + | 2562 | WP_227011095.1 | phage tail protein | - |
| P9J39_RS08905 (P9J39_08905) | 1873088..1873510 | + | 423 | WP_190269116.1 | tail fiber assembly protein | - |
| P9J39_RS08910 (P9J39_08910) | 1873514..1874080 | - | 567 | WP_193362365.1 | serine acetyltransferase | - |
| P9J39_RS08915 (P9J39_08915) | 1874162..1874572 | - | 411 | WP_045897211.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P9J39_RS08920 (P9J39_08920) | 1874593..1874772 | - | 180 | WP_012906750.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P9J39_RS08925 (P9J39_08925) | 1875045..1875284 | + | 240 | WP_048229971.1 | hypothetical protein | - |
| P9J39_RS08930 (P9J39_08930) | 1875284..1875604 | + | 321 | WP_193362276.1 | hypothetical protein | - |
| P9J39_RS08935 (P9J39_08935) | 1875867..1877150 | - | 1284 | WP_023299884.1 | YeaH/YhbH family protein | - |
| P9J39_RS08940 (P9J39_08940) | 1877240..1879174 | - | 1935 | WP_006809140.1 | protein kinase YeaG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1834201..1879174 | 44973 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6644.85 Da Isoelectric Point: 10.9132
>T276163 WP_012906750.1 NZ_CP121269:c1874772-1874593 [Enterobacter hormaechei subsp. xiangfangensis]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14874.79 Da Isoelectric Point: 4.3170
>AT276163 WP_045897211.1 NZ_CP121269:c1874572-1874162 [Enterobacter hormaechei subsp. xiangfangensis]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDDYQDAIESVREAIEAHIELLVEDGEAVPEATTVENWLSDPEYAGAVWALVD
VDITRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDDYQDAIESVREAIEAHIELLVEDGEAVPEATTVENWLSDPEYAGAVWALVD
VDITRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|