Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1106976..1107596 | Replicon | chromosome |
| Accession | NZ_CP121269 | ||
| Organism | Enterobacter hormaechei subsp. xiangfangensis strain F81Y | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | P9J39_RS05235 | Protein ID | WP_015571250.1 |
| Coordinates | 1106976..1107194 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | P9J39_RS05240 | Protein ID | WP_006809850.1 |
| Coordinates | 1107222..1107596 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P9J39_RS05205 (P9J39_05205) | 1102988..1103248 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| P9J39_RS05210 (P9J39_05210) | 1103251..1103391 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| P9J39_RS05215 (P9J39_05215) | 1103388..1104098 | - | 711 | WP_278108872.1 | GNAT family protein | - |
| P9J39_RS05220 (P9J39_05220) | 1104200..1105660 | + | 1461 | WP_033486652.1 | PLP-dependent aminotransferase family protein | - |
| P9J39_RS05225 (P9J39_05225) | 1105632..1106099 | - | 468 | WP_015571252.1 | YlaC family protein | - |
| P9J39_RS05230 (P9J39_05230) | 1106216..1106767 | - | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
| P9J39_RS05235 (P9J39_05235) | 1106976..1107194 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
| P9J39_RS05240 (P9J39_05240) | 1107222..1107596 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| P9J39_RS05245 (P9J39_05245) | 1108108..1111254 | - | 3147 | WP_023296042.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| P9J39_RS05250 (P9J39_05250) | 1111277..1112470 | - | 1194 | WP_017694395.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T276161 WP_015571250.1 NZ_CP121269:c1107194-1106976 [Enterobacter hormaechei subsp. xiangfangensis]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT276161 WP_006809850.1 NZ_CP121269:c1107596-1107222 [Enterobacter hormaechei subsp. xiangfangensis]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |