Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1106976..1107596 Replicon chromosome
Accession NZ_CP121269
Organism Enterobacter hormaechei subsp. xiangfangensis strain F81Y

Toxin (Protein)


Gene name Hha Uniprot ID A0A837FFM2
Locus tag P9J39_RS05235 Protein ID WP_015571250.1
Coordinates 1106976..1107194 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID F5RUW7
Locus tag P9J39_RS05240 Protein ID WP_006809850.1
Coordinates 1107222..1107596 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P9J39_RS05205 (P9J39_05205) 1102988..1103248 + 261 WP_015571255.1 type B 50S ribosomal protein L31 -
P9J39_RS05210 (P9J39_05210) 1103251..1103391 + 141 WP_003859006.1 type B 50S ribosomal protein L36 -
P9J39_RS05215 (P9J39_05215) 1103388..1104098 - 711 WP_278108872.1 GNAT family protein -
P9J39_RS05220 (P9J39_05220) 1104200..1105660 + 1461 WP_033486652.1 PLP-dependent aminotransferase family protein -
P9J39_RS05225 (P9J39_05225) 1105632..1106099 - 468 WP_015571252.1 YlaC family protein -
P9J39_RS05230 (P9J39_05230) 1106216..1106767 - 552 WP_015571251.1 maltose O-acetyltransferase -
P9J39_RS05235 (P9J39_05235) 1106976..1107194 - 219 WP_015571250.1 HHA domain-containing protein Toxin
P9J39_RS05240 (P9J39_05240) 1107222..1107596 - 375 WP_006809850.1 Hha toxicity modulator TomB Antitoxin
P9J39_RS05245 (P9J39_05245) 1108108..1111254 - 3147 WP_023296042.1 multidrug efflux RND transporter permease subunit AcrB -
P9J39_RS05250 (P9J39_05250) 1111277..1112470 - 1194 WP_017694395.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8583.95 Da        Isoelectric Point: 8.9008

>T276161 WP_015571250.1 NZ_CP121269:c1107194-1106976 [Enterobacter hormaechei subsp. xiangfangensis]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14497.28 Da        Isoelectric Point: 4.8989

>AT276161 WP_006809850.1 NZ_CP121269:c1107596-1107222 [Enterobacter hormaechei subsp. xiangfangensis]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A837FFM2

Antitoxin

Source ID Structure
AlphaFold DB A0A837FGN8

References