Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 508833..509469 | Replicon | chromosome |
| Accession | NZ_CP121266 | ||
| Organism | Bacillus subtilis strain 107105 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | P8R49_RS02615 | Protein ID | WP_003156187.1 |
| Coordinates | 509119..509469 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | P8R49_RS02610 | Protein ID | WP_003225183.1 |
| Coordinates | 508833..509114 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8R49_RS02590 (P8R49_02590) | 505192..505791 | - | 600 | WP_014478896.1 | rhomboid family intramembrane serine protease | - |
| P8R49_RS02595 (P8R49_02595) | 505886..506251 | + | 366 | WP_014478897.1 | holo-ACP synthase | - |
| P8R49_RS02600 (P8R49_02600) | 506417..507433 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
| P8R49_RS02605 (P8R49_02605) | 507548..508717 | + | 1170 | WP_014478898.1 | alanine racemase | - |
| P8R49_RS02610 (P8R49_02610) | 508833..509114 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| P8R49_RS02615 (P8R49_02615) | 509119..509469 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| P8R49_RS02620 (P8R49_02620) | 509585..510409 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| P8R49_RS02625 (P8R49_02625) | 510414..510779 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| P8R49_RS02630 (P8R49_02630) | 510783..511184 | + | 402 | WP_014478899.1 | serine/threonine-protein kinase RsbT | - |
| P8R49_RS02635 (P8R49_02635) | 511196..512203 | + | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
| P8R49_RS02640 (P8R49_02640) | 512272..512601 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
| P8R49_RS02645 (P8R49_02645) | 512598..513080 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| P8R49_RS02650 (P8R49_02650) | 513046..513834 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| P8R49_RS02655 (P8R49_02655) | 513834..514433 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T276157 WP_003156187.1 NZ_CP121266:509119-509469 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|