Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4164596..4165112 | Replicon | chromosome |
| Accession | NZ_CP121262 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 013 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | P8621_RS20290 | Protein ID | WP_000220578.1 |
| Coordinates | 4164596..4164880 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | P8621_RS20295 | Protein ID | WP_000212724.1 |
| Coordinates | 4164870..4165112 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8621_RS20275 (4159808) | 4159808..4161460 | + | 1653 | WP_000155057.1 | alpha,alpha-phosphotrehalase | - |
| P8621_RS20280 (4161869) | 4161869..4164007 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| P8621_RS20285 (4164128) | 4164128..4164592 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| P8621_RS20290 (4164596) | 4164596..4164880 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8621_RS20295 (4164870) | 4164870..4165112 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P8621_RS20300 (4165190) | 4165190..4167103 | - | 1914 | WP_001212137.1 | BglG family transcription antiterminator | - |
| P8621_RS20305 (4167120) | 4167120..4167860 | - | 741 | WP_000779263.1 | KDGP aldolase family protein | - |
| P8621_RS20310 (4167857) | 4167857..4168975 | - | 1119 | WP_001139187.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| P8621_RS20315 (4168959) | 4168959..4170092 | - | 1134 | WP_000459930.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T276153 WP_000220578.1 NZ_CP121262:c4164880-4164596 [Salmonella enterica subsp. enterica serovar Typhimurium]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |