Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4070379..4070955 | Replicon | chromosome |
Accession | NZ_CP121262 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 013 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | P8621_RS19895 | Protein ID | WP_001131963.1 |
Coordinates | 4070668..4070955 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | B5R9R5 |
Locus tag | P8621_RS19890 | Protein ID | WP_000063142.1 |
Coordinates | 4070379..4070681 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8621_RS19875 (4066889) | 4066889..4069039 | + | 2151 | WP_000379927.1 | pyruvate/proton symporter BtsT | - |
P8621_RS19880 (4069134) | 4069134..4069337 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
P8621_RS19885 (4069348) | 4069348..4070304 | + | 957 | WP_000187839.1 | GTPase | - |
P8621_RS19890 (4070379) | 4070379..4070681 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
P8621_RS19895 (4070668) | 4070668..4070955 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
P8621_RS19900 (4071224) | 4071224..4072138 | - | 915 | WP_000290512.1 | restriction endonuclease | - |
P8621_RS19905 (4072336) | 4072336..4075845 | + | 3510 | WP_001043484.1 | type I restriction-modification system endonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T276152 WP_001131963.1 NZ_CP121262:c4070955-4070668 [Salmonella enterica subsp. enterica serovar Typhimurium]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Download Length: 101 a.a. Molecular weight: 11373.96 Da Isoelectric Point: 10.1293
>AT276152 WP_000063142.1 NZ_CP121262:c4070681-4070379 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
MSMVKHKRGNASALSAQHEAELKALAKKSDDEIDYSDIPASEDGQWSEAVRGKFFRPLKTQASVRIDADVMEWLKRPGKG
YQTRLNAILREAMLREQNKK
Download Length: 303 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|