Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3470459..3471079 | Replicon | chromosome |
Accession | NZ_CP121262 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 013 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | P8621_RS17140 | Protein ID | WP_001280991.1 |
Coordinates | 3470861..3471079 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | P8621_RS17135 | Protein ID | WP_000344807.1 |
Coordinates | 3470459..3470833 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8621_RS17125 (3465598) | 3465598..3466791 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P8621_RS17130 (3466814) | 3466814..3469963 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
P8621_RS17135 (3470459) | 3470459..3470833 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
P8621_RS17140 (3470861) | 3470861..3471079 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
P8621_RS17145 (3471258) | 3471258..3471809 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
P8621_RS17150 (3471926) | 3471926..3472396 | + | 471 | WP_000136181.1 | YlaC family protein | - |
P8621_RS17155 (3472452) | 3472452..3472592 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
P8621_RS17160 (3472598) | 3472598..3472858 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
P8621_RS17165 (3473083) | 3473083..3474633 | + | 1551 | WP_000213139.1 | EAL domain-containing protein | - |
P8621_RS17175 (3474864) | 3474864..3475253 | + | 390 | WP_000961285.1 | MGMT family protein | - |
P8621_RS17180 (3475286) | 3475286..3475855 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T276149 WP_001280991.1 NZ_CP121262:3470861-3471079 [Salmonella enterica subsp. enterica serovar Typhimurium]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT276149 WP_000344807.1 NZ_CP121262:3470459-3470833 [Salmonella enterica subsp. enterica serovar Typhimurium]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|