Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5834509..5835133 | Replicon | chromosome |
Accession | NZ_CP121261 | ||
Organism | Achromobacter spanius strain LIG8 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | P8T11_RS26140 | Protein ID | WP_268079350.1 |
Coordinates | 5834951..5835133 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P8T11_RS26135 | Protein ID | WP_268079351.1 |
Coordinates | 5834509..5834901 (-) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T11_RS26115 (P8T11_26115) | 5829998..5831452 | - | 1455 | WP_268079354.1 | sensor histidine kinase | - |
P8T11_RS26120 (P8T11_26120) | 5831456..5832160 | - | 705 | WP_268079353.1 | response regulator transcription factor | - |
P8T11_RS26125 (P8T11_26125) | 5832350..5833690 | + | 1341 | WP_277549605.1 | CitMHS family transporter | - |
P8T11_RS26130 (P8T11_26130) | 5833728..5834468 | + | 741 | WP_268079352.1 | SDR family oxidoreductase | - |
P8T11_RS26135 (P8T11_26135) | 5834509..5834901 | - | 393 | WP_268079351.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
P8T11_RS26140 (P8T11_26140) | 5834951..5835133 | - | 183 | WP_268079350.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
P8T11_RS26145 (P8T11_26145) | 5835302..5835643 | + | 342 | WP_268079349.1 | hypothetical protein | - |
P8T11_RS26150 (P8T11_26150) | 5835662..5836099 | - | 438 | WP_268079348.1 | hypothetical protein | - |
P8T11_RS26155 (P8T11_26155) | 5836563..5836766 | + | 204 | WP_050448526.1 | cold-shock protein | - |
P8T11_RS26160 (P8T11_26160) | 5836835..5837092 | + | 258 | WP_259251979.1 | hypothetical protein | - |
P8T11_RS26165 (P8T11_26165) | 5837285..5838202 | + | 918 | WP_268079347.1 | DUF808 domain-containing protein | - |
P8T11_RS26170 (P8T11_26170) | 5838453..5839322 | + | 870 | WP_268079346.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5788251..6043241 | 254990 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6765.99 Da Isoelectric Point: 12.1585
>T276137 WP_268079350.1 NZ_CP121261:c5835133-5834951 [Achromobacter spanius]
MNSREIIRQLRQAGWVFRHAKGSHHIFVHPQKPGHISVPHPKKDLGIGLVTKLLTQAGLK
MNSREIIRQLRQAGWVFRHAKGSHHIFVHPQKPGHISVPHPKKDLGIGLVTKLLTQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13915.77 Da Isoelectric Point: 4.2687
>AT276137 WP_268079351.1 NZ_CP121261:c5834901-5834509 [Achromobacter spanius]
MKYPIAIEPGSETQAWGVVVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDSGTPVPVATSIAGHQANPEFAGWIWA
IVEIDPAVMDDTIERINITLPRRILARIDAKARAAGESRSGYIAHLALTH
MKYPIAIEPGSETQAWGVVVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDSGTPVPVATSIAGHQANPEFAGWIWA
IVEIDPAVMDDTIERINITLPRRILARIDAKARAAGESRSGYIAHLALTH
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|