Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 3349951..3350478 | Replicon | chromosome |
Accession | NZ_CP121261 | ||
Organism | Achromobacter spanius strain LIG8 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P8T11_RS14885 | Protein ID | WP_268081220.1 |
Coordinates | 3349951..3350226 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P8T11_RS14890 | Protein ID | WP_268081219.1 |
Coordinates | 3350260..3350478 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T11_RS14865 (P8T11_14865) | 3345535..3346560 | - | 1026 | WP_268081222.1 | tripartite tricarboxylate transporter substrate binding protein | - |
P8T11_RS14870 (P8T11_14870) | 3346509..3347573 | - | 1065 | WP_268081221.1 | NADPH:quinone oxidoreductase family protein | - |
P8T11_RS14875 (P8T11_14875) | 3347573..3348739 | - | 1167 | WP_268082351.1 | CoA transferase | - |
P8T11_RS14880 (P8T11_14880) | 3348935..3349924 | + | 990 | WP_268082350.1 | LysR family transcriptional regulator | - |
P8T11_RS14885 (P8T11_14885) | 3349951..3350226 | - | 276 | WP_268081220.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P8T11_RS14890 (P8T11_14890) | 3350260..3350478 | - | 219 | WP_268081219.1 | stability determinant | Antitoxin |
P8T11_RS14895 (P8T11_14895) | 3350804..3351262 | + | 459 | WP_268081218.1 | hypothetical protein | - |
P8T11_RS14900 (P8T11_14900) | 3351280..3352227 | + | 948 | WP_268081217.1 | sensor domain-containing diguanylate cyclase | - |
P8T11_RS14905 (P8T11_14905) | 3352477..3353715 | + | 1239 | WP_268081216.1 | sulfite oxidase | - |
P8T11_RS14910 (P8T11_14910) | 3353816..3354103 | + | 288 | WP_268081215.1 | cytochrome c | - |
P8T11_RS14915 (P8T11_14915) | 3354152..3354637 | - | 486 | WP_268081214.1 | DUF2214 domain-containing protein | - |
P8T11_RS14920 (P8T11_14920) | 3354656..3355042 | - | 387 | WP_268081213.1 | DUF6152 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10350.74 Da Isoelectric Point: 5.0264
>T276135 WP_268081220.1 NZ_CP121261:c3350226-3349951 [Achromobacter spanius]
MLPIFWSASALDDLDEITNYIAEYDVHAAIGMHELIENAVHPASEHPYLYRPGRVPGTREIVAHPNYILVYEVRADHIGV
IAVMHARQEYP
MLPIFWSASALDDLDEITNYIAEYDVHAAIGMHELIENAVHPASEHPYLYRPGRVPGTREIVAHPNYILVYEVRADHIGV
IAVMHARQEYP
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|