Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2553961..2554556 | Replicon | chromosome |
| Accession | NZ_CP121261 | ||
| Organism | Achromobacter spanius strain LIG8 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | P8T11_RS11285 | Protein ID | WP_268081866.1 |
| Coordinates | 2553961..2554143 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | P8T11_RS11290 | Protein ID | WP_268081865.1 |
| Coordinates | 2554167..2554556 (+) | Length | 130 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8T11_RS11260 (P8T11_11260) | 2549224..2549799 | + | 576 | WP_268081871.1 | TRAP transporter small permease | - |
| P8T11_RS11265 (P8T11_11265) | 2549796..2551076 | + | 1281 | WP_268081870.1 | TRAP transporter large permease subunit | - |
| P8T11_RS11270 (P8T11_11270) | 2551141..2551842 | + | 702 | WP_268081869.1 | protocatechuate 3,4-dioxygenase subunit beta | - |
| P8T11_RS11275 (P8T11_11275) | 2551846..2552424 | + | 579 | WP_268081868.1 | protocatechuate 3,4-dioxygenase subunit alpha | - |
| P8T11_RS11280 (P8T11_11280) | 2552446..2553858 | + | 1413 | WP_268081867.1 | 3-carboxy-cis,cis-muconate cycloisomerase | - |
| P8T11_RS11285 (P8T11_11285) | 2553961..2554143 | + | 183 | WP_268081866.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P8T11_RS11290 (P8T11_11290) | 2554167..2554556 | + | 390 | WP_268081865.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P8T11_RS11295 (P8T11_11295) | 2554644..2555027 | + | 384 | WP_268081864.1 | GFA family protein | - |
| P8T11_RS11300 (P8T11_11300) | 2555141..2555344 | - | 204 | WP_172616244.1 | cold-shock protein | - |
| P8T11_RS11305 (P8T11_11305) | 2555569..2555907 | - | 339 | WP_268081863.1 | hypothetical protein | - |
| P8T11_RS11310 (P8T11_11310) | 2556278..2557105 | - | 828 | WP_268081862.1 | hypothetical protein | - |
| P8T11_RS11315 (P8T11_11315) | 2557326..2558276 | + | 951 | WP_268081861.1 | nitronate monooxygenase | - |
| P8T11_RS11320 (P8T11_11320) | 2558444..2559415 | - | 972 | WP_268081860.1 | tripartite tricarboxylate transporter substrate binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6728.84 Da Isoelectric Point: 11.4487
>T276134 WP_268081866.1 NZ_CP121261:2553961-2554143 [Achromobacter spanius]
MNSADIIKRLKADGWYLVHSVGSHHQFKHPTKRGKVTVPHPRKDLPAPTAHSILKQAGLR
MNSADIIKRLKADGWYLVHSVGSHHQFKHPTKRGKVTVPHPRKDLPAPTAHSILKQAGLR
Download Length: 183 bp
Antitoxin
Download Length: 130 a.a. Molecular weight: 14135.17 Da Isoelectric Point: 6.6400
>AT276134 WP_268081865.1 NZ_CP121261:2554167-2554556 [Achromobacter spanius]
VLYLIYVHKEKGSAYGASFPDFPGCHAAATTLQELPSAAQEAVEAHFFGETQPIPSPSAPDVWMQKKAFQGGFWMLVDID
LSKVNTKAVRLNISLPENLVHRIDAVARARRLSRSAFLALAAEHEMEAA
VLYLIYVHKEKGSAYGASFPDFPGCHAAATTLQELPSAAQEAVEAHFFGETQPIPSPSAPDVWMQKKAFQGGFWMLVDID
LSKVNTKAVRLNISLPENLVHRIDAVARARRLSRSAFLALAAEHEMEAA
Download Length: 390 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|