Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2553961..2554556 Replicon chromosome
Accession NZ_CP121261
Organism Achromobacter spanius strain LIG8

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag P8T11_RS11285 Protein ID WP_268081866.1
Coordinates 2553961..2554143 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag P8T11_RS11290 Protein ID WP_268081865.1
Coordinates 2554167..2554556 (+) Length 130 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P8T11_RS11260 (P8T11_11260) 2549224..2549799 + 576 WP_268081871.1 TRAP transporter small permease -
P8T11_RS11265 (P8T11_11265) 2549796..2551076 + 1281 WP_268081870.1 TRAP transporter large permease subunit -
P8T11_RS11270 (P8T11_11270) 2551141..2551842 + 702 WP_268081869.1 protocatechuate 3,4-dioxygenase subunit beta -
P8T11_RS11275 (P8T11_11275) 2551846..2552424 + 579 WP_268081868.1 protocatechuate 3,4-dioxygenase subunit alpha -
P8T11_RS11280 (P8T11_11280) 2552446..2553858 + 1413 WP_268081867.1 3-carboxy-cis,cis-muconate cycloisomerase -
P8T11_RS11285 (P8T11_11285) 2553961..2554143 + 183 WP_268081866.1 type II toxin-antitoxin system HicA family toxin Toxin
P8T11_RS11290 (P8T11_11290) 2554167..2554556 + 390 WP_268081865.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
P8T11_RS11295 (P8T11_11295) 2554644..2555027 + 384 WP_268081864.1 GFA family protein -
P8T11_RS11300 (P8T11_11300) 2555141..2555344 - 204 WP_172616244.1 cold-shock protein -
P8T11_RS11305 (P8T11_11305) 2555569..2555907 - 339 WP_268081863.1 hypothetical protein -
P8T11_RS11310 (P8T11_11310) 2556278..2557105 - 828 WP_268081862.1 hypothetical protein -
P8T11_RS11315 (P8T11_11315) 2557326..2558276 + 951 WP_268081861.1 nitronate monooxygenase -
P8T11_RS11320 (P8T11_11320) 2558444..2559415 - 972 WP_268081860.1 tripartite tricarboxylate transporter substrate binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-122)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6728.84 Da        Isoelectric Point: 11.4487

>T276134 WP_268081866.1 NZ_CP121261:2553961-2554143 [Achromobacter spanius]
MNSADIIKRLKADGWYLVHSVGSHHQFKHPTKRGKVTVPHPRKDLPAPTAHSILKQAGLR

Download         Length: 183 bp

Antitoxin


Download         Length: 130 a.a.        Molecular weight: 14135.17 Da        Isoelectric Point: 6.6400

>AT276134 WP_268081865.1 NZ_CP121261:2554167-2554556 [Achromobacter spanius]
VLYLIYVHKEKGSAYGASFPDFPGCHAAATTLQELPSAAQEAVEAHFFGETQPIPSPSAPDVWMQKKAFQGGFWMLVDID
LSKVNTKAVRLNISLPENLVHRIDAVARARRLSRSAFLALAAEHEMEAA

Download         Length: 390 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References