Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1596993..1597660 | Replicon | chromosome |
Accession | NZ_CP121261 | ||
Organism | Achromobacter spanius strain LIG8 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P8T11_RS06985 | Protein ID | WP_268077631.1 |
Coordinates | 1597241..1597660 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | P8T11_RS06980 | Protein ID | WP_268077632.1 |
Coordinates | 1596993..1597244 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8T11_RS06960 (P8T11_06960) | 1592231..1594198 | - | 1968 | WP_268077636.1 | NYN domain-containing protein | - |
P8T11_RS06965 (P8T11_06965) | 1594496..1595395 | + | 900 | WP_268077635.1 | MotA/TolQ/ExbB proton channel family protein | - |
P8T11_RS06970 (P8T11_06970) | 1595392..1596375 | + | 984 | WP_268077634.1 | OmpA family protein | - |
P8T11_RS06975 (P8T11_06975) | 1596539..1596892 | + | 354 | WP_268077633.1 | YciI family protein | - |
P8T11_RS06980 (P8T11_06980) | 1596993..1597244 | + | 252 | WP_268077632.1 | Arc family DNA-binding protein | Antitoxin |
P8T11_RS06985 (P8T11_06985) | 1597241..1597660 | + | 420 | WP_268077631.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P8T11_RS06990 (P8T11_06990) | 1597802..1598212 | + | 411 | WP_268077630.1 | YciI family protein | - |
P8T11_RS06995 (P8T11_06995) | 1598231..1598638 | + | 408 | WP_268077629.1 | VOC family protein | - |
P8T11_RS07000 (P8T11_07000) | 1598635..1599909 | + | 1275 | WP_268077628.1 | RNA polymerase sigma factor | - |
P8T11_RS07005 (P8T11_07005) | 1599996..1600865 | + | 870 | WP_268077627.1 | AraC family transcriptional regulator | - |
P8T11_RS07010 (P8T11_07010) | 1600947..1601906 | + | 960 | WP_268077626.1 | DMT family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14660.88 Da Isoelectric Point: 4.8181
>T276133 WP_268077631.1 NZ_CP121261:1597241-1597660 [Achromobacter spanius]
MILLDTNVISEPLRQAPADAVIEWIDRQPLETLFLSAVTVAELRFGVACMPVGKRRDALHGDLEQRVLALFAGRILAFDT
SASLEYVALMARARASGQAIGGPDGYIAATAAAHGMSVATRDVAPFEAAGVSVINPWGA
MILLDTNVISEPLRQAPADAVIEWIDRQPLETLFLSAVTVAELRFGVACMPVGKRRDALHGDLEQRVLALFAGRILAFDT
SASLEYVALMARARASGQAIGGPDGYIAATAAAHGMSVATRDVAPFEAAGVSVINPWGA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|