Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09907-MazE |
Location | 7411..8012 | Replicon | plasmid pPLAN223 |
Accession | NZ_CP121259 | ||
Organism | Lactiplantibacillus plantarum strain SPC-SNU-72-1 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | Q684P1 |
Locus tag | P6165_RS15875 | Protein ID | WP_001748110.1 |
Coordinates | 7668..8012 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A806J926 |
Locus tag | P6165_RS15870 | Protein ID | WP_001748109.1 |
Coordinates | 7411..7674 (+) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6165_RS15850 (P6165_15850) | 3544..4047 | + | 504 | WP_278163029.1 | DUF536 domain-containing protein | - |
P6165_RS15855 (P6165_15855) | 4752..5129 | + | 378 | WP_003646093.1 | YxeA family protein | - |
P6165_RS15860 (P6165_15860) | 6170..6382 | - | 213 | WP_278163030.1 | hypothetical protein | - |
P6165_RS15865 (P6165_15865) | 6738..7325 | - | 588 | WP_278163032.1 | site-specific integrase | - |
P6165_RS15870 (P6165_15870) | 7411..7674 | + | 264 | WP_001748109.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
P6165_RS15875 (P6165_15875) | 7668..8012 | + | 345 | WP_001748110.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P6165_RS15880 (P6165_15880) | 8131..9462 | - | 1332 | WP_278163043.1 | NAD(P)/FAD-dependent oxidoreductase | - |
P6165_RS15885 (P6165_15885) | 9480..9611 | - | 132 | WP_015474697.1 | hypothetical protein | - |
P6165_RS15890 (P6165_15890) | 9624..10271 | - | 648 | WP_006844821.1 | DsbA family oxidoreductase | - |
P6165_RS15895 (P6165_15895) | 10290..11234 | - | 945 | WP_278163045.1 | thioredoxin-disulfide reductase | - |
P6165_RS15900 (P6165_15900) | 11325..11453 | - | 129 | Protein_12 | aspartate racemase | - |
P6165_RS15905 (P6165_15905) | 11453..11776 | - | 324 | WP_006844823.1 | thioredoxin family protein | - |
P6165_RS15910 (P6165_15910) | 11797..12111 | - | 315 | WP_015474701.1 | thioredoxin | - |
P6165_RS15915 (P6165_15915) | 12125..12406 | - | 282 | WP_008855846.1 | thioredoxin family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..22390 | 22390 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13041.89 Da Isoelectric Point: 6.4782
>T276132 WP_001748110.1 NZ_CP121259:7668-8012 [Lactiplantibacillus plantarum]
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
MVSQGDIFYVNFNPSRGHEQMNKRPAIALSNDLVCQTSNMTIVAPISSTKRNFPMYHRLTSSQTVYGKVLLDQTIALDLR
ARHVTDETIVDHVSREELEEIITLYKLLFSIDDK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R2K1X3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806J926 |