Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 1667655..1668267 | Replicon | chromosome |
| Accession | NZ_CP121250 | ||
| Organism | Streptococcus pyogenes strain 1044 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | J7M9F1 |
| Locus tag | P8191_RS08620 | Protein ID | WP_010922665.1 |
| Coordinates | 1667655..1667990 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q5X9X9 |
| Locus tag | P8191_RS08625 | Protein ID | WP_002988079.1 |
| Coordinates | 1667980..1668267 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8191_RS08585 (P8191_08585) | 1663033..1663551 | + | 519 | WP_002982682.1 | NYN domain-containing protein | - |
| P8191_RS08590 (P8191_08590) | 1663648..1664508 | + | 861 | WP_002982687.1 | DegV family protein | - |
| P8191_RS08595 (P8191_08595) | 1664644..1665150 | + | 507 | WP_002988070.1 | hypothetical protein | - |
| P8191_RS08600 (P8191_08600) | 1665147..1665353 | + | 207 | WP_002982695.1 | helix-turn-helix transcriptional regulator | - |
| P8191_RS08605 (P8191_08605) | 1665571..1666017 | + | 447 | WP_002982710.1 | 50S ribosomal protein L13 | - |
| P8191_RS08610 (P8191_08610) | 1666038..1666430 | + | 393 | WP_002982716.1 | 30S ribosomal protein S9 | - |
| P8191_RS08615 (P8191_08615) | 1666550..1667557 | - | 1008 | Protein_1653 | site-specific integrase | - |
| P8191_RS08620 (P8191_08620) | 1667655..1667990 | - | 336 | WP_010922665.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P8191_RS08625 (P8191_08625) | 1667980..1668267 | - | 288 | WP_002988079.1 | DNA-damage-inducible protein J | Antitoxin |
| P8191_RS08630 (P8191_08630) | 1668928..1669701 | - | 774 | WP_002982738.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| P8191_RS08635 (P8191_08635) | 1670148..1670576 | + | 429 | WP_010922664.1 | galactose-6-phosphate isomerase subunit LacA | - |
| P8191_RS08640 (P8191_08640) | 1670611..1671126 | + | 516 | WP_002988082.1 | galactose-6-phosphate isomerase subunit LacB | - |
| P8191_RS08645 (P8191_08645) | 1671174..1672103 | + | 930 | WP_010922663.1 | tagatose-6-phosphate kinase | - |
| P8191_RS08650 (P8191_08650) | 1672107..1673090 | + | 984 | WP_002982755.1 | tagatose-bisphosphate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13185.99 Da Isoelectric Point: 5.2144
>T276131 WP_010922665.1 NZ_CP121250:c1667990-1667655 [Streptococcus pyogenes]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQRKMEQIISDIEKLEVFPEVGFDADEKYGSKIIHYHSTKGYTLSKD
YIVLYHIEGEENRIVIDYLLPTQSDYIKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | J7M9F1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4U7GX94 |