Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 715881..716434 | Replicon | chromosome |
| Accession | NZ_CP121247 | ||
| Organism | Arcanobacterium wilhelmae strain DSM 102162 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | P8A24_RS03135 | Protein ID | WP_278059644.1 |
| Coordinates | 716132..716434 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | P8A24_RS03130 | Protein ID | WP_278059642.1 |
| Coordinates | 715881..716126 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8A24_RS03105 (P8A24_03105) | 710971..712233 | - | 1263 | WP_278059636.1 | MFS transporter | - |
| P8A24_RS03110 (P8A24_03110) | 712325..713329 | - | 1005 | Protein_604 | DUF5692 family protein | - |
| P8A24_RS03115 (P8A24_03115) | 713327..713668 | + | 342 | Protein_605 | hypothetical protein | - |
| P8A24_RS03120 (P8A24_03120) | 713756..714748 | + | 993 | WP_278059638.1 | DUF5692 family protein | - |
| P8A24_RS03125 (P8A24_03125) | 714806..715780 | - | 975 | WP_278059639.1 | EamA family transporter | - |
| P8A24_RS03130 (P8A24_03130) | 715881..716126 | + | 246 | WP_278059642.1 | YlcI/YnfO family protein | Antitoxin |
| P8A24_RS03135 (P8A24_03135) | 716132..716434 | + | 303 | WP_278059644.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P8A24_RS03140 (P8A24_03140) | 716676..717098 | + | 423 | WP_278059646.1 | DUF2871 family protein | - |
| P8A24_RS03145 (P8A24_03145) | 717205..718173 | + | 969 | WP_278059648.1 | pirin family protein | - |
| P8A24_RS03150 (P8A24_03150) | 718333..719472 | + | 1140 | WP_278059650.1 | L-lactate dehydrogenase | - |
| P8A24_RS03155 (P8A24_03155) | 719611..721014 | - | 1404 | WP_278059652.1 | argininosuccinate lyase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11179.10 Da Isoelectric Point: 8.0184
>T276129 WP_278059644.1 NZ_CP121247:716132-716434 [Arcanobacterium wilhelmae]
MREIRLAKLDKTRPVLILTREIALPAMRKVTVAPITSTIRGLTSEVRVGQRNGLDHECVVALDNITTIPQTLLGKRIGYF
FDEQESELSLGLSLAFDLPF
MREIRLAKLDKTRPVLILTREIALPAMRKVTVAPITSTIRGLTSEVRVGQRNGLDHECVVALDNITTIPQTLLGKRIGYF
FDEQESELSLGLSLAFDLPF
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|