Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-DUF971 |
Location | 2066296..2066881 | Replicon | chromosome |
Accession | NZ_CP121246 | ||
Organism | Agrobacterium pusense strain 973_Rhizob3 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | P9K39_RS22550 | Protein ID | WP_278067940.1 |
Coordinates | 2066579..2066881 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | P9K39_RS22545 | Protein ID | WP_278067939.1 |
Coordinates | 2066296..2066586 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9K39_RS22525 (P9K39_22525) | 2062399..2063406 | + | 1008 | WP_278067935.1 | iron-siderophore ABC transporter substrate-binding protein | - |
P9K39_RS22530 (P9K39_22530) | 2063403..2064446 | + | 1044 | WP_278067936.1 | iron ABC transporter permease | - |
P9K39_RS22535 (P9K39_22535) | 2064449..2065483 | + | 1035 | WP_278067937.1 | iron chelate uptake ABC transporter family permease subunit | - |
P9K39_RS22540 (P9K39_22540) | 2065480..2066292 | + | 813 | WP_278067938.1 | ABC transporter ATP-binding protein | - |
P9K39_RS22545 (P9K39_22545) | 2066296..2066586 | - | 291 | WP_278067939.1 | putative addiction module antidote protein | Antitoxin |
P9K39_RS22550 (P9K39_22550) | 2066579..2066881 | - | 303 | WP_278067940.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9K39_RS22555 (P9K39_22555) | 2067043..2067915 | - | 873 | WP_278067941.1 | AraC family transcriptional regulator | - |
P9K39_RS22560 (P9K39_22560) | 2068048..2069262 | + | 1215 | WP_278067942.1 | amino acid ABC transporter substrate-binding protein | - |
P9K39_RS22565 (P9K39_22565) | 2069333..2070205 | + | 873 | WP_045533916.1 | branched-chain amino acid ABC transporter permease | - |
P9K39_RS22570 (P9K39_22570) | 2070202..2071110 | + | 909 | WP_035208323.1 | branched-chain amino acid ABC transporter permease | - |
P9K39_RS22575 (P9K39_22575) | 2071107..2071835 | + | 729 | WP_112637227.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11124.70 Da Isoelectric Point: 9.5496
>T276127 WP_278067940.1 NZ_CP121246:c2066881-2066579 [Agrobacterium pusense]
MQIKQSTTFKKWFGKLKDERGKAIIASRLNRLSFGHAGDVAPVGNGISELRIHYGPGYRVYFIISDDVVVVLLCGGNKST
QEKDIRAARVIAAQWSDDDE
MQIKQSTTFKKWFGKLKDERGKAIIASRLNRLSFGHAGDVAPVGNGISELRIHYGPGYRVYFIISDDVVVVLLCGGNKST
QEKDIRAARVIAAQWSDDDE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|