Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
Location | 2050311..2050855 | Replicon | chromosome |
Accession | NZ_CP121245 | ||
Organism | Agrobacterium pusense strain 973_Rhizob3 |
Toxin (Protein)
Gene name | parE | Uniprot ID | U4PRC3 |
Locus tag | P9K39_RS09815 | Protein ID | WP_004440407.1 |
Coordinates | 2050565..2050855 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | U4PRA7 |
Locus tag | P9K39_RS09810 | Protein ID | WP_022555750.1 |
Coordinates | 2050311..2050562 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P9K39_RS09785 (P9K39_09785) | 2045409..2046098 | - | 690 | WP_003520496.1 | HAD family hydrolase | - |
P9K39_RS09790 (P9K39_09790) | 2046313..2046993 | + | 681 | WP_004440402.1 | GntR family transcriptional regulator | - |
P9K39_RS09795 (P9K39_09795) | 2047034..2047495 | + | 462 | WP_072494876.1 | DUF1284 domain-containing protein | - |
P9K39_RS09800 (P9K39_09800) | 2047455..2048555 | - | 1101 | WP_278067271.1 | hypothetical protein | - |
P9K39_RS09805 (P9K39_09805) | 2048792..2049937 | + | 1146 | WP_004440405.1 | site-specific DNA-methyltransferase | - |
P9K39_RS09810 (P9K39_09810) | 2050311..2050562 | + | 252 | WP_022555750.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
P9K39_RS09815 (P9K39_09815) | 2050565..2050855 | + | 291 | WP_004440407.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P9K39_RS09820 (P9K39_09820) | 2050887..2051498 | - | 612 | WP_022555751.1 | HAD family phosphatase | - |
P9K39_RS09825 (P9K39_09825) | 2051495..2052598 | - | 1104 | WP_278067272.1 | A/G-specific adenine glycosylase | - |
P9K39_RS09830 (P9K39_09830) | 2052696..2053223 | + | 528 | WP_006699987.1 | DUF721 domain-containing protein | - |
P9K39_RS09835 (P9K39_09835) | 2053352..2054032 | + | 681 | WP_006309853.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11253.77 Da Isoelectric Point: 6.6456
>T276126 WP_004440407.1 NZ_CP121245:2050565-2050855 [Agrobacterium pusense]
MGFRLSLPAEEDVIRIAQEGIDLFGPQQARKYHRELFAIFDLISRNPRIARERNELSPSVRIHPFRAHLVVYRVEADDDV
LIVRVRHGHEDWGNEP
MGFRLSLPAEEDVIRIAQEGIDLFGPQQARKYHRELFAIFDLISRNPRIARERNELSPSVRIHPFRAHLVVYRVEADDDV
LIVRVRHGHEDWGNEP
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U4PRC3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A098RRB9 |