Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2723936..2724507 | Replicon | chromosome |
Accession | NZ_CP121233 | ||
Organism | Enterococcus faecalis strain SVJ-EF01 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | ORD27_RS13305 | Protein ID | WP_002360937.1 |
Coordinates | 2723936..2724277 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S4CGQ1 |
Locus tag | ORD27_RS13310 | Protein ID | WP_002367500.1 |
Coordinates | 2724277..2724507 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORD27_RS13300 (2719696) | 2719696..2723310 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
ORD27_RS13305 (2723936) | 2723936..2724277 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
ORD27_RS13310 (2724277) | 2724277..2724507 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
ORD27_RS13315 (2724921) | 2724921..2725136 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
ORD27_RS13320 (2725275) | 2725275..2726267 | + | 993 | WP_010776203.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
ORD27_RS13325 (2726334) | 2726334..2726720 | - | 387 | WP_244323692.1 | RloB domain-containing protein | - |
ORD27_RS13330 (2726672) | 2726672..2726950 | - | 279 | WP_253544428.1 | RloB family protein | - |
ORD27_RS13335 (2726959) | 2726959..2728254 | - | 1296 | WP_010824051.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T276123 WP_002360937.1 NZ_CP121233:c2724277-2723936 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S4CGQ1 |