Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 75676..76329 | Replicon | chromosome |
| Accession | NZ_CP121233 | ||
| Organism | Enterococcus faecalis strain SVJ-EF01 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | R3IHS7 |
| Locus tag | ORD27_RS00325 | Protein ID | WP_002367585.1 |
| Coordinates | 76147..76329 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | R3IHD2 |
| Locus tag | ORD27_RS00320 | Protein ID | WP_010707936.1 |
| Coordinates | 75676..76113 (-) | Length | 146 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORD27_RS00305 (70952) | 70952..71650 | + | 699 | WP_010707934.1 | N-acetylmannosamine-6-phosphate 2-epimerase | - |
| ORD27_RS00310 (71828) | 71828..74167 | + | 2340 | WP_071646506.1 | alpha-glucosidase | - |
| ORD27_RS00315 (74714) | 74714..75631 | + | 918 | WP_010713649.1 | helix-turn-helix transcriptional regulator | - |
| ORD27_RS00320 (75676) | 75676..76113 | - | 438 | WP_010707936.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| ORD27_RS00325 (76147) | 76147..76329 | - | 183 | WP_002367585.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| ORD27_RS00330 (76434) | 76434..77087 | - | 654 | WP_002356081.1 | Crp/Fnr family transcriptional regulator | - |
| ORD27_RS00335 (77361) | 77361..78254 | + | 894 | WP_010775474.1 | SDR family oxidoreductase | - |
| ORD27_RS00340 (78267) | 78267..78839 | + | 573 | WP_071646507.1 | alkaline shock response membrane anchor protein AmaP | - |
| ORD27_RS00345 (78852) | 78852..79043 | + | 192 | WP_002356087.1 | DUF2273 domain-containing protein | - |
| ORD27_RS00350 (79056) | 79056..79568 | + | 513 | WP_002383483.1 | Asp23/Gls24 family envelope stress response protein | - |
| ORD27_RS00355 (79627) | 79627..80187 | + | 561 | WP_002356090.1 | Asp23/Gls24 family envelope stress response protein | - |
| ORD27_RS00360 (80211) | 80211..80453 | + | 243 | WP_002356092.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| ORD27_RS00365 (80619) | 80619..81134 | + | 516 | WP_071646508.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6633.06 Da Isoelectric Point: 10.8756
>T276106 WP_002367585.1 NZ_CP121233:c76329-76147 [Enterococcus faecalis]
MPMTQKQMVKLLKKHGWLPTDGGKGSHIKMEMSGKRPIIIPHGELKKGTEIGILKEAGLK
MPMTQKQMVKLLKKHGWLPTDGGKGSHIKMEMSGKRPIIIPHGELKKGTEIGILKEAGLK
Download Length: 183 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16267.27 Da Isoelectric Point: 4.2758
>AT276106 WP_010707936.1 NZ_CP121233:c76113-75676 [Enterococcus faecalis]
MLISYPACFYSVENGYYVYFPDIGGSGTQGDTIPDAIAMASDYLGMMLSDDIEHQRTIHQPSPINTLSLEDNNPFRDDDD
FNFNLADSFVSMVNVELNDYLGTNTLVKKTVTIPKWSDELGKKNKLNFSKTLTDAIVEKSLHVLK
MLISYPACFYSVENGYYVYFPDIGGSGTQGDTIPDAIAMASDYLGMMLSDDIEHQRTIHQPSPINTLSLEDNNPFRDDDD
FNFNLADSFVSMVNVELNDYLGTNTLVKKTVTIPKWSDELGKKNKLNFSKTLTDAIVEKSLHVLK
Download Length: 438 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|