Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3489981..3490776 Replicon chromosome
Accession NZ_CP121223
Organism Shigella flexneri 2a strain Sflex 21-42

Toxin (Protein)


Gene name yeeV Uniprot ID Q93EZ7
Locus tag P5F89_RS19230 Protein ID WP_000854917.1
Coordinates 3489981..3490355 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID D2ACA1
Locus tag P5F89_RS19235 Protein ID WP_001280958.1
Coordinates 3490402..3490776 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5F89_RS19195 (3485590) 3485590..3486528 - 939 Protein_3323 glyoxylate/hydroxypyruvate reductase GhrA -
P5F89_RS19205 (3487000) 3487000..3487281 - 282 Protein_3324 DUF4942 domain-containing protein -
P5F89_RS19210 (3487563) 3487563..3488567 - 1005 WP_001179707.1 IS110-like element ISSfl8 family transposase -
P5F89_RS19215 (3488639) 3488639..3489199 - 561 Protein_3326 DUF4942 domain-containing protein -
P5F89_RS19220 (3489284) 3489284..3489481 - 198 WP_000839282.1 DUF957 domain-containing protein -
P5F89_RS19225 (3489493) 3489493..3489984 - 492 WP_000976828.1 DUF5983 family protein -
P5F89_RS19230 (3489981) 3489981..3490355 - 375 WP_000854917.1 TA system toxin CbtA family protein Toxin
P5F89_RS19235 (3490402) 3490402..3490776 - 375 WP_001280958.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P5F89_RS19240 (3490939) 3490939..3491160 - 222 WP_001220314.1 DUF987 domain-containing protein -
P5F89_RS19245 (3491223) 3491223..3491699 - 477 WP_005011624.1 RadC family protein -
P5F89_RS19250 (3491715) 3491715..3492188 - 474 WP_005011597.1 antirestriction protein -
P5F89_RS19255 (3492530) 3492530..3493351 - 822 WP_001234584.1 DUF932 domain-containing protein -
P5F89_RS19260 (3493451) 3493451..3493624 - 174 WP_000088744.1 DUF905 family protein -
P5F89_RS19265 (3493744) 3493744..3494007 - 264 WP_000466628.1 DNA polymerase III subunit gamma/tau -
P5F89_RS19275 (3494976) 3494976..3495362 - 387 Protein_3338 AraC family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island tet(B) / ant(3'')-Ia / blaOXA-1 / catA1 csgE / csgF / csgG / csgB 3459404..3509482 50078
- flank IS/Tn - - 3487563..3488567 1004


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 14145.22 Da        Isoelectric Point: 7.7761

>T276098 WP_000854917.1 NZ_CP121223:c3490355-3489981 [Shigella flexneri 2a]
MKTLSDTHVREVSRCPSPVTIWQTLLIRLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13793.62 Da        Isoelectric Point: 6.4651

>AT276098 WP_001280958.1 NZ_CP121223:c3490776-3490402 [Shigella flexneri 2a]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLYYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q93EZ7

Antitoxin

Source ID Structure
AlphaFold DB A0A0K4PAV2

References