Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 871018..871819 | Replicon | chromosome |
| Accession | NZ_CP121223 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D3GUT5 |
| Locus tag | P5F89_RS06275 | Protein ID | WP_001094430.1 |
| Coordinates | 871442..871819 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | D3GUT4 |
| Locus tag | P5F89_RS06270 | Protein ID | WP_001285620.1 |
| Coordinates | 871018..871395 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS06240 (867639) | 867639..868094 | + | 456 | WP_005051844.1 | IrmA family protein | - |
| P5F89_RS06245 (868237) | 868237..868326 | + | 90 | WP_112031555.1 | DUF905 family protein | - |
| P5F89_RS06250 (868505) | 868505..869323 | + | 819 | WP_001177758.1 | DUF932 domain-containing protein | - |
| P5F89_RS06255 (869665) | 869665..870138 | + | 474 | WP_000855059.1 | antirestriction protein | - |
| P5F89_RS06260 (870154) | 870154..870630 | + | 477 | WP_001387238.1 | RadC family protein | - |
| P5F89_RS06265 (870717) | 870717..870938 | + | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| P5F89_RS06270 (871018) | 871018..871395 | + | 378 | WP_001285620.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| P5F89_RS06275 (871442) | 871442..871819 | + | 378 | WP_001094430.1 | TA system toxin CbtA family protein | Toxin |
| P5F89_RS06280 (871816) | 871816..872304 | + | 489 | WP_000761715.1 | DUF5983 family protein | - |
| P5F89_RS06285 (872324) | 872324..872521 | + | 198 | WP_000772029.1 | DUF957 domain-containing protein | - |
| P5F89_RS06290 (872606) | 872606..873448 | + | 843 | WP_001290187.1 | DUF4942 domain-containing protein | - |
| P5F89_RS06295 (874225) | 874225..874470 | + | 246 | WP_000875412.1 | hypothetical protein | - |
| P5F89_RS06300 (874873) | 874873..876035 | + | 1163 | WP_094081514.1 | IS3-like element IS3 family transposase | - |
| P5F89_RS06305 (876139) | 876139..876606 | - | 468 | WP_011069513.1 | prepilin peptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13971.82 Da Isoelectric Point: 6.8608
>T276092 WP_001094430.1 NZ_CP121223:871442-871819 [Shigella flexneri 2a]
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
MNTLPDTHVREASGCPSPITIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRDNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13698.52 Da Isoelectric Point: 5.9505
>AT276092 WP_001285620.1 NZ_CP121223:871018-871395 [Shigella flexneri 2a]
VSDTLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
VSDTLPGTTPPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDVDAYHLDQAFPLLMKQLELMLTGG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPAAPATTV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y6M7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2INW | |
| AlphaFold DB | A0A0E0Y522 |