Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 748667..749321 | Replicon | chromosome |
Accession | NZ_CP121223 | ||
Organism | Shigella flexneri 2a strain Sflex 21-42 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | Q0T101 |
Locus tag | P5F89_RS05665 | Protein ID | WP_000244767.1 |
Coordinates | 748667..749074 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | D2A730 |
Locus tag | P5F89_RS05670 | Protein ID | WP_000354052.1 |
Coordinates | 749055..749321 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5F89_RS05645 (744624) | 744624..746357 | - | 1734 | WP_000813187.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P5F89_RS05650 (746363) | 746363..747073 | - | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P5F89_RS05655 (747098) | 747098..747994 | - | 897 | WP_000806987.1 | site-specific tyrosine recombinase XerD | - |
P5F89_RS05660 (748106) | 748106..748627 | + | 522 | WP_001055867.1 | flavodoxin FldB | - |
P5F89_RS05665 (748667) | 748667..749074 | - | 408 | WP_000244767.1 | protein YgfX | Toxin |
P5F89_RS05670 (749055) | 749055..749321 | - | 267 | WP_000354052.1 | FAD assembly factor SdhE | Antitoxin |
P5F89_RS05675 (749564) | 749564..750544 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
P5F89_RS05680 (750740) | 750740..751399 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
P5F89_RS05685 (751563) | 751563..751873 | - | 311 | Protein_704 | N(4)-acetylcytidine aminohydrolase | - |
P5F89_RS05690 (751918) | 751918..753351 | + | 1434 | WP_005051722.1 | 6-phospho-beta-glucosidase BglA | - |
P5F89_RS05695 (753408) | 753408..754151 | - | 744 | WP_000951957.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15978.91 Da Isoelectric Point: 10.9373
>T276091 WP_000244767.1 NZ_CP121223:c749074-748667 [Shigella flexneri 2a]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRCINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TIU0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D2A730 |