Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 131443..132218 Replicon plasmid unnamed5
Accession NZ_CP121222
Organism Shigella flexneri 2a strain Sflex 21-42

Toxin (Protein)


Gene name tacT Uniprot ID Q7BEG9
Locus tag P5F89_RS01480 Protein ID WP_000405245.1
Coordinates 131443..131925 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q7BEG8
Locus tag P5F89_RS01485 Protein ID WP_010921625.1
Coordinates 131916..132218 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5F89_RS01465 (P5F89_01455) 127825..129549 + 1725 WP_010921638.1 T3SS effector E3 ubiquitin-protein ligase IpaH4.5 -
P5F89_RS01470 (P5F89_01460) 129601..130809 + 1209 Protein_153 IS3 family transposase -
P5F89_RS01475 (P5F89_01465) 130852..131375 - 524 Protein_154 IS3-like element ISSfl11 family transposase -
P5F89_RS01480 (P5F89_01470) 131443..131925 - 483 WP_000405245.1 GNAT family N-acetyltransferase Toxin
P5F89_RS01485 (P5F89_01475) 131916..132218 - 303 WP_010921625.1 DUF1778 domain-containing protein Antitoxin
P5F89_RS01490 (P5F89_01480) 132490..132762 + 273 WP_000019158.1 hypothetical protein -
P5F89_RS01495 (P5F89_01485) 132743..133951 + 1209 WP_000198552.1 IS91 family transposase -
P5F89_RS01500 (P5F89_01490) 134123..134251 + 129 Protein_159 IS5/IS1182 family transposase -
P5F89_RS01505 (P5F89_01495) 134400..135854 - 1455 WP_000701108.1 type 3 secretion system effector OspC2 -
P5F89_RS01510 (P5F89_01500) 136258..136877 + 620 Protein_161 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 1..225592 225592
- inside IScluster/Tn - ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 93431..139236 45805


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(29-149)

Antitoxin

Vibrio phage ICP1, Orf50

(19-94)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17750.52 Da        Isoelectric Point: 7.0382

>T276090 WP_000405245.1 NZ_CP121222:c131925-131443 [Shigella flexneri 2a]
MEINVTAPALLTDEHILQPFDCGNEVLSNWLRGRAMKNQMLNASRTFVICLEDTLRIVGYYSLATGSVTHAELGRSLRHN
MPNPVPVVLLGRLAVDVCTQGHGFGKWLLSDAIHRVVNLADQVGIKAVMVHAIDDDARAFYERFGFVQSVVAPNTLFYKV

Download         Length: 483 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11689.28 Da        Isoelectric Point: 4.9167

>AT276090 WP_010921625.1 NZ_CP121222:c132218-131916 [Shigella flexneri 2a]
MEVFMSTAASVRKTPREHQINIRATDEERAVIDYAASLVNKNRTDFIMELAYQEAKNIILDQRLFVLDNERYDSFITQLE
APVQNAEGRERLMAVKPEWK

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q7BEG9

Antitoxin

Source ID Structure
AlphaFold DB Q7BEG8

References