Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/ElaA-DUF1778
Location 106114..106871 Replicon plasmid unnamed5
Accession NZ_CP121222
Organism Shigella flexneri 2a strain Sflex 21-42

Toxin (Protein)


Gene name tacT Uniprot ID D2AJG5
Locus tag P5F89_RS01330 Protein ID WP_000501974.1
Coordinates 106386..106871 (+) Length 162 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID Q31SN8
Locus tag P5F89_RS01325 Protein ID WP_011114751.1
Coordinates 106114..106398 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5F89_RS01305 (P5F89_01295) 102175..102849 + 675 WP_004967157.1 IS66-like element accessory protein TnpA -
P5F89_RS01310 (P5F89_01300) 102846..103196 + 351 WP_005048975.1 IS66 family insertion sequence element accessory protein TnpB -
P5F89_RS01315 (P5F89_01305) 103193..104794 + 1602 WP_005063916.1 IS66-like element ISSfl3 family transposase -
P5F89_RS01320 (P5F89_01310) 105048..105212 - 165 WP_001346193.1 hypothetical protein -
P5F89_RS01325 (P5F89_01315) 106114..106398 + 285 WP_011114751.1 DUF1778 domain-containing protein Antitoxin
P5F89_RS01330 (P5F89_01320) 106386..106871 + 486 WP_000501974.1 GNAT family N-acetyltransferase Toxin
P5F89_RS01335 (P5F89_01325) 107044..107325 - 282 Protein_126 IS4/IS5 family transposase -
P5F89_RS01340 (P5F89_01330) 107392..108548 + 1157 WP_094085527.1 IS3-like element IS600 family transposase -
P5F89_RS01345 (P5F89_01335) 108618..109891 + 1274 WP_094081497.1 IS3-like element IS2 family transposase -
P5F89_RS01350 (P5F89_01340) 109929..110072 + 144 Protein_129 DUF3440 domain-containing protein -
P5F89_RS01355 (P5F89_01345) 110057..110695 + 639 WP_000502854.1 ParB N-terminal domain-containing protein -
P5F89_RS01360 (P5F89_01350) 110923..111347 + 425 Protein_131 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 93431..139236 45805
- inside Non-Mobilizable plasmid - ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 1..225592 225592


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(27-151)

Antitoxin

Vibrio phage ICP1, Orf50

(12-88)


Sequences

Toxin        


Download         Length: 162 a.a.        Molecular weight: 17814.63 Da        Isoelectric Point: 9.8822

>T276089 WP_000501974.1 NZ_CP121222:106386-106871 [Shigella flexneri 2a]
MGCVTAPEPLSSFHQVAEFVSSEAVLDDWLKQKELKNQAIGATRTFVVCRKGTQQIVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTENAKQFYIHHGFKPSKTQVQTLFLKLP
Q

Download         Length: 486 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10871.52 Da        Isoelectric Point: 4.6812

>AT276089 WP_011114751.1 NZ_CP121222:106114-106398 [Shigella flexneri 2a]
MIYGGFMKSGVQLNLRARESQRILIDAAAEILHKSRTDFILEMACKAAEDVILDRRVFNFNDRQYEEFIEMLDAPVADDP
AIEKLLARKPQWDV

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PN28

Antitoxin

Source ID Structure
AlphaFold DB A0A4V1CUJ1

References