Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 106114..106871 | Replicon | plasmid unnamed5 |
| Accession | NZ_CP121222 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | D2AJG5 |
| Locus tag | P5F89_RS01330 | Protein ID | WP_000501974.1 |
| Coordinates | 106386..106871 (+) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | Q31SN8 |
| Locus tag | P5F89_RS01325 | Protein ID | WP_011114751.1 |
| Coordinates | 106114..106398 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS01305 (P5F89_01295) | 102175..102849 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
| P5F89_RS01310 (P5F89_01300) | 102846..103196 | + | 351 | WP_005048975.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| P5F89_RS01315 (P5F89_01305) | 103193..104794 | + | 1602 | WP_005063916.1 | IS66-like element ISSfl3 family transposase | - |
| P5F89_RS01320 (P5F89_01310) | 105048..105212 | - | 165 | WP_001346193.1 | hypothetical protein | - |
| P5F89_RS01325 (P5F89_01315) | 106114..106398 | + | 285 | WP_011114751.1 | DUF1778 domain-containing protein | Antitoxin |
| P5F89_RS01330 (P5F89_01320) | 106386..106871 | + | 486 | WP_000501974.1 | GNAT family N-acetyltransferase | Toxin |
| P5F89_RS01335 (P5F89_01325) | 107044..107325 | - | 282 | Protein_126 | IS4/IS5 family transposase | - |
| P5F89_RS01340 (P5F89_01330) | 107392..108548 | + | 1157 | WP_094085527.1 | IS3-like element IS600 family transposase | - |
| P5F89_RS01345 (P5F89_01335) | 108618..109891 | + | 1274 | WP_094081497.1 | IS3-like element IS2 family transposase | - |
| P5F89_RS01350 (P5F89_01340) | 109929..110072 | + | 144 | Protein_129 | DUF3440 domain-containing protein | - |
| P5F89_RS01355 (P5F89_01345) | 110057..110695 | + | 639 | WP_000502854.1 | ParB N-terminal domain-containing protein | - |
| P5F89_RS01360 (P5F89_01350) | 110923..111347 | + | 425 | Protein_131 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 | 93431..139236 | 45805 | |
| - | inside | Non-Mobilizable plasmid | - | ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 | 1..225592 | 225592 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17814.63 Da Isoelectric Point: 9.8822
>T276089 WP_000501974.1 NZ_CP121222:106386-106871 [Shigella flexneri 2a]
MGCVTAPEPLSSFHQVAEFVSSEAVLDDWLKQKELKNQAIGATRTFVVCRKGTQQIVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTENAKQFYIHHGFKPSKTQVQTLFLKLP
Q
MGCVTAPEPLSSFHQVAEFVSSEAVLDDWLKQKELKNQAIGATRTFVVCRKGTQQIVGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDVSFRGKGLGADLLHDAVRRCYRVAENIGVRAIMVHALTENAKQFYIHHGFKPSKTQVQTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A822PN28 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4V1CUJ1 |