Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 17558..18117 Replicon plasmid unnamed5
Accession NZ_CP121222
Organism Shigella flexneri 2a strain Sflex 21-42

Toxin (Protein)


Gene name relE Uniprot ID D2AJT2
Locus tag P5F89_RS00805 Protein ID WP_000421262.1
Coordinates 17558..17833 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A822PWA0
Locus tag P5F89_RS00810 Protein ID WP_011114774.1
Coordinates 17833..18117 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5F89_RS00780 14434..14541 - 108 WP_023592908.1 transposase domain-containing protein -
P5F89_RS00785 (P5F89_00775) 14565..14870 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB -
P5F89_RS00790 (P5F89_00780) 14872..15090 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA -
P5F89_RS00795 (P5F89_00785) 15626..16579 - 954 Protein_18 IS66 family transposase -
P5F89_RS00800 (P5F89_00790) 16635..17332 + 698 WP_227804301.1 IS1 family transposase -
P5F89_RS00805 (P5F89_00795) 17558..17833 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P5F89_RS00810 (P5F89_00800) 17833..18117 - 285 WP_011114774.1 ribbon-helix-helix domain-containing protein Antitoxin
P5F89_RS00815 (P5F89_00805) 18569..18820 + 252 WP_015683204.1 transporter -
P5F89_RS00820 (P5F89_00810) 18870..19079 + 210 Protein_23 peptidoglycan-binding protein -
P5F89_RS00825 (P5F89_00815) 19179..19364 - 186 Protein_24 ATP-binding protein -
P5F89_RS00830 (P5F89_00820) 19553..21154 - 1602 WP_011110603.1 IS66-like element ISSfl3 family transposase -
P5F89_RS00835 (P5F89_00825) 21174..21521 - 348 WP_000631708.1 IS66 family insertion sequence element accessory protein TnpB -
P5F89_RS00840 (P5F89_00830) 21518..22192 - 675 WP_004967157.1 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 1..225592 225592
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 7996..29866 21870


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10766.48 Da        Isoelectric Point: 9.9324

>T276088 WP_000421262.1 NZ_CP121222:c17833-17558 [Shigella flexneri 2a]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFTGEYEIRYELTGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10529.97 Da        Isoelectric Point: 6.2150

>AT276088 WP_011114774.1 NZ_CP121222:c18117-17833 [Shigella flexneri 2a]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQSW
ADSLSTDHLLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A822PVM3

Antitoxin

Source ID Structure
AlphaFold DB A0A822PWA0

References