Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 14565..15090 Replicon plasmid unnamed5
Accession NZ_CP121222
Organism Shigella flexneri 2a strain Sflex 21-42

Toxin (Protein)


Gene name ccdB Uniprot ID Q326Z8
Locus tag P5F89_RS00785 Protein ID WP_001159860.1
Coordinates 14565..14870 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID Q7BEK0
Locus tag P5F89_RS00790 Protein ID WP_000813626.1
Coordinates 14872..15090 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5F89_RS00755 (P5F89_00750) 10593..10859 - 267 Protein_10 IS66 family insertion sequence element accessory protein TnpB -
P5F89_RS00760 (P5F89_00755) 11216..11806 - 591 WP_000705601.1 type III secretion system effector protein kinase OspG -
P5F89_RS00765 (P5F89_00760) 11889..12058 - 170 Protein_12 type II toxin-antitoxin system toxin YacB -
P5F89_RS00770 (P5F89_00765) 12058..12327 - 270 Protein_13 type II toxin-antitoxin system antitoxin YacA -
P5F89_RS00775 (P5F89_00770) 12535..14172 - 1638 WP_000936806.1 T3SS effector E3 ubiquitin-protein ligase IpaH9.8 -
P5F89_RS00780 14434..14541 - 108 WP_023592908.1 transposase domain-containing protein -
P5F89_RS00785 (P5F89_00775) 14565..14870 - 306 WP_001159860.1 type II toxin-antitoxin system toxin CcdB Toxin
P5F89_RS00790 (P5F89_00780) 14872..15090 - 219 WP_000813626.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
P5F89_RS00795 (P5F89_00785) 15626..16579 - 954 Protein_18 IS66 family transposase -
P5F89_RS00800 (P5F89_00790) 16635..17332 + 698 WP_227804301.1 IS1 family transposase -
P5F89_RS00805 (P5F89_00795) 17558..17833 - 276 WP_000421262.1 type II toxin-antitoxin system RelE/ParE family toxin -
P5F89_RS00810 (P5F89_00800) 17833..18117 - 285 WP_011114774.1 ribbon-helix-helix domain-containing protein -
P5F89_RS00815 (P5F89_00805) 18569..18820 + 252 WP_015683204.1 transporter -
P5F89_RS00820 (P5F89_00810) 18870..19079 + 210 Protein_23 peptidoglycan-binding protein -
P5F89_RS00825 (P5F89_00815) 19179..19364 - 186 Protein_24 ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 1..225592 225592
- inside IScluster/Tn - ospG / ipaH9.8 / ospI 7996..29866 21870


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11736.59 Da        Isoelectric Point: 6.4674

>T276087 WP_001159860.1 NZ_CP121222:c14870-14565 [Shigella flexneri 2a]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8333.36 Da        Isoelectric Point: 6.2838

>AT276087 WP_000813626.1 NZ_CP121222:c15090-14872 [Shigella flexneri 2a]
MKQRITVTIDSDSYQLLKSANVNISGLVNTAMQKEARRLRAERWQAENQQGMAEIARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TTN3

Antitoxin

Source ID Structure
AlphaFold DB Q7BEK0

References