Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 14565..15090 | Replicon | plasmid unnamed5 |
| Accession | NZ_CP121222 | ||
| Organism | Shigella flexneri 2a strain Sflex 21-42 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | Q326Z8 |
| Locus tag | P5F89_RS00785 | Protein ID | WP_001159860.1 |
| Coordinates | 14565..14870 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | Q7BEK0 |
| Locus tag | P5F89_RS00790 | Protein ID | WP_000813626.1 |
| Coordinates | 14872..15090 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5F89_RS00755 (P5F89_00750) | 10593..10859 | - | 267 | Protein_10 | IS66 family insertion sequence element accessory protein TnpB | - |
| P5F89_RS00760 (P5F89_00755) | 11216..11806 | - | 591 | WP_000705601.1 | type III secretion system effector protein kinase OspG | - |
| P5F89_RS00765 (P5F89_00760) | 11889..12058 | - | 170 | Protein_12 | type II toxin-antitoxin system toxin YacB | - |
| P5F89_RS00770 (P5F89_00765) | 12058..12327 | - | 270 | Protein_13 | type II toxin-antitoxin system antitoxin YacA | - |
| P5F89_RS00775 (P5F89_00770) | 12535..14172 | - | 1638 | WP_000936806.1 | T3SS effector E3 ubiquitin-protein ligase IpaH9.8 | - |
| P5F89_RS00780 | 14434..14541 | - | 108 | WP_023592908.1 | transposase domain-containing protein | - |
| P5F89_RS00785 (P5F89_00775) | 14565..14870 | - | 306 | WP_001159860.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| P5F89_RS00790 (P5F89_00780) | 14872..15090 | - | 219 | WP_000813626.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| P5F89_RS00795 (P5F89_00785) | 15626..16579 | - | 954 | Protein_18 | IS66 family transposase | - |
| P5F89_RS00800 (P5F89_00790) | 16635..17332 | + | 698 | WP_227804301.1 | IS1 family transposase | - |
| P5F89_RS00805 (P5F89_00795) | 17558..17833 | - | 276 | WP_000421262.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P5F89_RS00810 (P5F89_00800) | 17833..18117 | - | 285 | WP_011114774.1 | ribbon-helix-helix domain-containing protein | - |
| P5F89_RS00815 (P5F89_00805) | 18569..18820 | + | 252 | WP_015683204.1 | transporter | - |
| P5F89_RS00820 (P5F89_00810) | 18870..19079 | + | 210 | Protein_23 | peptidoglycan-binding protein | - |
| P5F89_RS00825 (P5F89_00815) | 19179..19364 | - | 186 | Protein_24 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ospG / ipaH9.8 / ospI / papC / icsA/virG / virA / spa40 / spa29 / spa9 / spa24 / spa33 / spa32 / spa13 / spa47 / spa15 / mxiA / mxiC / mxiD / mxiE / mxiM / mxiL / mxiN / mxiK / mxiJ / mxiI / mxiH / mxiG / ipgF / ipgE / ipgD / icsB / ipgA / ipgB1 / ipgC / ipaB / ipaC / ipaD / ipaA / ipaJ / ospC3 / ospC1 / ospD3/senA / ipaH7.8 / ipaH4.5 / ospC2 / ipaH2.5 / ospE2 / ipgB2 / ospD1 / ospF / ospD2 / ospC2 / ospC4 / ospB / icsP/sopA / nleE / ospE1 / ipaH1.4 | 1..225592 | 225592 | |
| - | inside | IScluster/Tn | - | ospG / ipaH9.8 / ospI | 7996..29866 | 21870 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11736.59 Da Isoelectric Point: 6.4674
>T276087 WP_001159860.1 NZ_CP121222:c14870-14565 [Shigella flexneri 2a]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPIFVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4P7TTN3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q7BEK0 |