Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 39385..39920 Replicon plasmid unnamed4
Accession NZ_CP121221
Organism Shigella flexneri 2a strain Sflex 21-42

Toxin (Protein)


Gene name relE Uniprot ID A0A0M1UJC2
Locus tag P5F89_RS00335 Protein ID WP_001270422.1
Coordinates 39385..39672 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID L4J0V6
Locus tag P5F89_RS00340 Protein ID WP_001132895.1
Coordinates 39669..39920 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5F89_RS00310 (34523) 34523..35692 - 1170 WP_001072359.1 hypothetical protein -
P5F89_RS00315 (36059) 36059..36247 + 189 WP_001332784.1 hypothetical protein -
P5F89_RS00320 (36368) 36368..37108 + 741 WP_001066947.1 tyrosine-type recombinase/integrase -
P5F89_RS00325 (37351) 37351..38328 - 978 WP_001309253.1 RepB family plasmid replication initiator protein -
P5F89_RS00330 (38972) 38972..39383 - 412 Protein_50 DDE-type integrase/transposase/recombinase -
P5F89_RS00335 (39385) 39385..39672 - 288 WP_001270422.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P5F89_RS00340 (39669) 39669..39920 - 252 WP_001132895.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P5F89_RS00345 (40093) 40093..40224 - 132 WP_001309255.1 hypothetical protein -
P5F89_RS00350 (40678) 40678..41883 + 1206 WP_000817635.1 AAA family ATPase -
P5F89_RS00355 (41880) 41880..42842 + 963 WP_000756328.1 ParB family protein -
P5F89_RS00360 (43076) 43076..43852 + 777 Protein_56 transposase DNA-binding-containing protein -
P5F89_RS00365 (43981) 43981..44064 - 84 Protein_57 DUF4113 domain-containing protein -
P5F89_RS00370 (44066) 44066..44594 + 529 Protein_58 DUF1281 domain-containing protein -
P5F89_RS00375 (44591) 44591..44902 + 312 WP_001309256.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib / sul2 / tet(A) / blaOXA-1 / aac(6')-Ib-cr - 1..96218 96218


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11262.30 Da        Isoelectric Point: 10.4703

>T276084 WP_001270422.1 NZ_CP121221:c39672-39385 [Shigella flexneri 2a]
MRYQVKFREDALKEWQKMDKTIQQQFAKKLKKCCDNPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDEQLIIAVVAVGK
RERSDVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9178.47 Da        Isoelectric Point: 4.2108

>AT276084 WP_001132895.1 NZ_CP121221:c39920-39669 [Shigella flexneri 2a]
MPNIILSDTSASVSELKKNPMATVSAGDGFPVAILNRNQPAFYCVPAELYEKMLDALDDQELVKLVAERSNQPLHDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M1UJC2

Antitoxin

Source ID Structure
AlphaFold DB L4J0V6

References