Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/YafQ-RelB
Location 723221..723795 Replicon chromosome
Accession NZ_CP121208
Organism Arcanobacterium canis strain DSM 25104

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag P7079_RS03225 Protein ID WP_278013393.1
Coordinates 723565..723795 (+) Length 77 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag P7079_RS03220 Protein ID WP_278013392.1
Coordinates 723221..723484 (+) Length 88 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7079_RS03180 (P7079_03180) 718337..719143 + 807 WP_278013386.1 hypothetical protein -
P7079_RS03185 (P7079_03185) 719169..719615 + 447 WP_278013387.1 ribosome silencing factor -
P7079_RS03190 (P7079_03190) 719612..720262 + 651 WP_278013388.1 histidine phosphatase family protein -
P7079_RS03200 (P7079_03200) 720875..721324 + 450 WP_278013389.1 SAR2788 family putative toxin -
P7079_RS03205 (P7079_03205) 721321..721812 + 492 WP_278013390.1 hypothetical protein -
P7079_RS03210 (P7079_03210) 722212..722475 + 264 WP_278013391.1 IS3 family transposase -
P7079_RS03215 (P7079_03215) 722488..722850 + 363 WP_278013596.1 DDE-type integrase/transposase/recombinase -
P7079_RS03220 (P7079_03220) 723221..723484 + 264 WP_278013392.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
P7079_RS03225 (P7079_03225) 723565..723795 + 231 WP_278013393.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
P7079_RS03230 (P7079_03230) 724306..725316 - 1011 WP_278013394.1 IS30 family transposase -
P7079_RS03235 (P7079_03235) 726212..726778 - 567 WP_278013395.1 ClbS/DfsB family four-helix bundle protein -
P7079_RS03240 (P7079_03240) 727472..727801 + 330 WP_278013396.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 724306..725316 1010


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(2-73)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(3-85)


Sequences

Toxin        


Download         Length: 77 a.a.        Molecular weight: 8757.14 Da        Isoelectric Point: 8.5695

>T276079 WP_278013393.1 NZ_CP121208:723565-723795 [Arcanobacterium canis]
MSLLKGVIQLIVQNDKESLVELRRRHRMHELKGNWAGAKECHVANLGDWLCVWQVSDGLAIFLRTGTRDEIFRSNP

Download         Length: 231 bp

Antitoxin


Download         Length: 88 a.a.        Molecular weight: 9736.83 Da        Isoelectric Point: 4.1173

>AT276079 WP_278013392.1 NZ_CP121208:723221-723484 [Arcanobacterium canis]
MGSVTVRVDDETKEAAAAIAEDFGFDLSSVTRAFYKQMIRENRIPLNLSYGEPNDTSLEALAEAKRMFEEGQSRFETPEQ
VFEALGI

Download         Length: 264 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References