Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2238453..2238982 | Replicon | chromosome |
Accession | NZ_CP121204 | ||
Organism | Staphylococcus aureus strain SA0907 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | P7F77_RS11310 | Protein ID | WP_000621175.1 |
Coordinates | 2238453..2238815 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | T1YCG8 |
Locus tag | P7F77_RS11315 | Protein ID | WP_000948331.1 |
Coordinates | 2238812..2238982 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7F77_RS11290 (2235431) | 2235431..2236201 | - | 771 | WP_001041107.1 | RNA polymerase sigma factor SigB | - |
P7F77_RS11295 (2236176) | 2236176..2236655 | - | 480 | WP_001190825.1 | anti-sigma B factor RsbW | - |
P7F77_RS11300 (2236657) | 2236657..2236983 | - | 327 | WP_001052491.1 | anti-sigma factor antagonist | - |
P7F77_RS11305 (2237102) | 2237102..2238103 | - | 1002 | WP_000390829.1 | PP2C family protein-serine/threonine phosphatase | - |
P7F77_RS11310 (2238453) | 2238453..2238815 | - | 363 | WP_000621175.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P7F77_RS11315 (2238812) | 2238812..2238982 | - | 171 | WP_000948331.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P7F77_RS11320 (2239067) | 2239067..2240215 | - | 1149 | WP_001281140.1 | alanine racemase | - |
P7F77_RS11325 (2240281) | 2240281..2240640 | - | 360 | WP_000581197.1 | holo-ACP synthase | - |
P7F77_RS11330 (2240644) | 2240644..2241135 | - | 492 | WP_001205908.1 | PH domain-containing protein | - |
P7F77_RS11335 (2241122) | 2241122..2242705 | - | 1584 | WP_001294637.1 | PH domain-containing protein | - |
P7F77_RS11340 (2242698) | 2242698..2243177 | - | 480 | WP_001287077.1 | hypothetical protein | - |
P7F77_RS11345 (2243385) | 2243385..2243945 | - | 561 | WP_001092406.1 | K(+)-transporting ATPase subunit C | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13441.69 Da Isoelectric Point: 10.1654
>T276076 WP_000621175.1 NZ_CP121204:c2238815-2238453 [Staphylococcus aureus]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTYLSDDKMKEVDNALMISLGLNAVAHQKN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|