Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 2136447..2137253 Replicon chromosome
Accession NZ_CP121204
Organism Staphylococcus aureus strain SA0907

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag P7F77_RS10735 Protein ID WP_000525003.1
Coordinates 2136789..2137253 (+) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag P7F77_RS10730 Protein ID WP_001573842.1
Coordinates 2136447..2136776 (+) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7F77_RS10670 (2131699) 2131699..2132178 - 480 WP_000002516.1 siphovirus Gp157 family protein -
P7F77_RS10675 (2132193) 2132193..2132453 - 261 WP_048667633.1 DUF1108 family protein -
P7F77_RS10680 (2132547) 2132547..2132708 - 162 WP_000048124.1 DUF1270 family protein -
P7F77_RS10685 (2132701) 2132701..2132922 - 222 WP_000594790.1 hypothetical protein -
P7F77_RS10690 (2132994) 2132994..2133659 + 666 WP_001807461.1 hypothetical protein -
P7F77_RS10695 (2133680) 2133680..2133748 - 69 Protein_2069 hypothetical protein -
P7F77_RS10700 (2133788) 2133788..2134012 - 225 WP_000187184.1 hypothetical protein -
P7F77_RS10705 (2134013) 2134013..2134792 - 780 WP_001148557.1 phage antirepressor KilAC domain-containing protein -
P7F77_RS10710 (2134849) 2134849..2135058 + 210 WP_000642492.1 hypothetical protein -
P7F77_RS10715 (2135048) 2135048..2135191 - 144 WP_000939498.1 hypothetical protein -
P7F77_RS10720 (2135220) 2135220..2135996 - 777 WP_278043635.1 Rha family transcriptional regulator -
P7F77_RS10725 (2136010) 2136010..2136255 - 246 WP_001573844.1 helix-turn-helix transcriptional regulator -
P7F77_RS10730 (2136447) 2136447..2136776 + 330 WP_001573842.1 helix-turn-helix transcriptional regulator Antitoxin
P7F77_RS10735 (2136789) 2136789..2137253 + 465 WP_000525003.1 hypothetical protein Toxin
P7F77_RS10740 (2137285) 2137285..2137965 + 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
P7F77_RS10745 (2138177) 2138177..2139226 + 1050 WP_001145730.1 tyrosine-type recombinase/integrase -
P7F77_RS10750 (2139294) 2139294..2140691 - 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -
P7F77_RS10755 (2140842) 2140842..2141306 - 465 WP_001010508.1 SUF system NifU family Fe-S cluster assembly protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - scn / chp / sak 2097654..2140691 43037


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(10-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18156.52 Da        Isoelectric Point: 4.7927

>T276074 WP_000525003.1 NZ_CP121204:2136789-2137253 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12730.33 Da        Isoelectric Point: 6.4836

>AT276074 WP_001573842.1 NZ_CP121204:2136447-2136776 [Staphylococcus aureus]
MRNNDEIITIIKTSMKEQNLSLSELARRVGVAKSAVSRYLNLTREFPLNRAEDFAKALSISTEYLLGFEKSEQKQEEPQH
RAAHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References