Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_XRE(antitoxin)
Location 1167043..1167849 Replicon chromosome
Accession NZ_CP121204
Organism Staphylococcus aureus strain SA0907

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag P7F77_RS05720 Protein ID WP_000525003.1
Coordinates 1167043..1167507 (-) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID -
Locus tag P7F77_RS05725 Protein ID WP_001573842.1
Coordinates 1167520..1167849 (-) Length 110 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P7F77_RS05695 (1162546) 1162546..1163685 - 1140 WP_000843619.1 nucleotidyltransferase -
P7F77_RS05700 (1163812) 1163812..1164369 + 558 WP_000872158.1 DUF177 domain-containing protein -
P7F77_RS05705 (1164449) 1164449..1164622 + 174 WP_000290472.1 50S ribosomal protein L32 -
P7F77_RS05710 (1164739) 1164739..1166124 - 1386 WP_000861313.1 recombinase family protein -
P7F77_RS05715 (1166331) 1166331..1167011 - 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
P7F77_RS05720 (1167043) 1167043..1167507 - 465 WP_000525003.1 hypothetical protein Toxin
P7F77_RS05725 (1167520) 1167520..1167849 - 330 WP_001573842.1 helix-turn-helix transcriptional regulator Antitoxin
P7F77_RS05730 (1168041) 1168041..1168286 + 246 WP_001573844.1 helix-turn-helix transcriptional regulator -
P7F77_RS05735 (1168300) 1168300..1169076 + 777 WP_278043635.1 Rha family transcriptional regulator -
P7F77_RS05740 (1169105) 1169105..1169248 + 144 WP_000939498.1 hypothetical protein -
P7F77_RS05745 (1169238) 1169238..1169447 - 210 WP_000642492.1 hypothetical protein -
P7F77_RS05750 (1169504) 1169504..1170280 + 777 WP_224209363.1 phage antirepressor KilAC domain-containing protein -
P7F77_RS05755 (1170297) 1170297..1170491 + 195 WP_000390105.1 hypothetical protein -
P7F77_RS05760 (1170695) 1170695..1170925 - 231 WP_000395457.1 hypothetical protein -
P7F77_RS05765 (1170984) 1170984..1171112 + 129 WP_001559112.1 hypothetical protein -
P7F77_RS05770 (1171105) 1171105..1171272 + 168 WP_001285957.1 DUF1270 domain-containing protein -
P7F77_RS05775 (1171273) 1171273..1171593 + 321 WP_000219666.1 hypothetical protein -
P7F77_RS05780 (1171687) 1171687..1171947 + 261 WP_000291075.1 DUF1108 family protein -
P7F77_RS05785 (1171956) 1171956..1172219 + 264 WP_001205732.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1164739..1208284 43545


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(10-65)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18156.52 Da        Isoelectric Point: 4.7927

>T276070 WP_000525003.1 NZ_CP121204:c1167507-1167043 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 110 a.a.        Molecular weight: 12730.33 Da        Isoelectric Point: 6.4836

>AT276070 WP_001573842.1 NZ_CP121204:c1167849-1167520 [Staphylococcus aureus]
MRNNDEIITIIKTSMKEQNLSLSELARRVGVAKSAVSRYLNLTREFPLNRAEDFAKALSISTEYLLGFEKSEQKQEEPQH
RAAHLEGELTDDEWQRVLDYADYIRSKRK

Download         Length: 330 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References