Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /HTH_XRE(antitoxin) |
| Location | 1167043..1167849 | Replicon | chromosome |
| Accession | NZ_CP121204 | ||
| Organism | Staphylococcus aureus strain SA0907 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | P7F77_RS05720 | Protein ID | WP_000525003.1 |
| Coordinates | 1167043..1167507 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | - |
| Locus tag | P7F77_RS05725 | Protein ID | WP_001573842.1 |
| Coordinates | 1167520..1167849 (-) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7F77_RS05695 (1162546) | 1162546..1163685 | - | 1140 | WP_000843619.1 | nucleotidyltransferase | - |
| P7F77_RS05700 (1163812) | 1163812..1164369 | + | 558 | WP_000872158.1 | DUF177 domain-containing protein | - |
| P7F77_RS05705 (1164449) | 1164449..1164622 | + | 174 | WP_000290472.1 | 50S ribosomal protein L32 | - |
| P7F77_RS05710 (1164739) | 1164739..1166124 | - | 1386 | WP_000861313.1 | recombinase family protein | - |
| P7F77_RS05715 (1166331) | 1166331..1167011 | - | 681 | WP_000392109.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| P7F77_RS05720 (1167043) | 1167043..1167507 | - | 465 | WP_000525003.1 | hypothetical protein | Toxin |
| P7F77_RS05725 (1167520) | 1167520..1167849 | - | 330 | WP_001573842.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| P7F77_RS05730 (1168041) | 1168041..1168286 | + | 246 | WP_001573844.1 | helix-turn-helix transcriptional regulator | - |
| P7F77_RS05735 (1168300) | 1168300..1169076 | + | 777 | WP_278043635.1 | Rha family transcriptional regulator | - |
| P7F77_RS05740 (1169105) | 1169105..1169248 | + | 144 | WP_000939498.1 | hypothetical protein | - |
| P7F77_RS05745 (1169238) | 1169238..1169447 | - | 210 | WP_000642492.1 | hypothetical protein | - |
| P7F77_RS05750 (1169504) | 1169504..1170280 | + | 777 | WP_224209363.1 | phage antirepressor KilAC domain-containing protein | - |
| P7F77_RS05755 (1170297) | 1170297..1170491 | + | 195 | WP_000390105.1 | hypothetical protein | - |
| P7F77_RS05760 (1170695) | 1170695..1170925 | - | 231 | WP_000395457.1 | hypothetical protein | - |
| P7F77_RS05765 (1170984) | 1170984..1171112 | + | 129 | WP_001559112.1 | hypothetical protein | - |
| P7F77_RS05770 (1171105) | 1171105..1171272 | + | 168 | WP_001285957.1 | DUF1270 domain-containing protein | - |
| P7F77_RS05775 (1171273) | 1171273..1171593 | + | 321 | WP_000219666.1 | hypothetical protein | - |
| P7F77_RS05780 (1171687) | 1171687..1171947 | + | 261 | WP_000291075.1 | DUF1108 family protein | - |
| P7F77_RS05785 (1171956) | 1171956..1172219 | + | 264 | WP_001205732.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1164739..1208284 | 43545 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 18156.52 Da Isoelectric Point: 4.7927
>T276070 WP_000525003.1 NZ_CP121204:c1167507-1167043 [Staphylococcus aureus]
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID
MGLYEETLIQHDYIEIREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|