Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | TscAT/- |
Location | 879637..880166 | Replicon | chromosome |
Accession | NZ_CP121204 | ||
Organism | Staphylococcus aureus strain SA0907 |
Toxin (Protein)
Gene name | TscT | Uniprot ID | K7ZRX2 |
Locus tag | P7F77_RS04195 | Protein ID | WP_001103933.1 |
Coordinates | 879849..880166 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | TscA | Uniprot ID | A0A6B0BJC0 |
Locus tag | P7F77_RS04190 | Protein ID | WP_001058487.1 |
Coordinates | 879637..879846 (+) | Length | 70 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7F77_RS04155 (876088) | 876088..876552 | + | 465 | WP_001085185.1 | SsrA-binding protein SmpB | - |
P7F77_RS04165 (877115) | 877115..878221 | - | 1107 | WP_000121223.1 | tyrosine-type recombinase/integrase | - |
P7F77_RS04170 (878227) | 878227..878844 | - | 618 | WP_223200480.1 | helix-turn-helix transcriptional regulator | - |
P7F77_RS04175 (879032) | 879032..879238 | + | 207 | WP_001060953.1 | hypothetical protein | - |
P7F77_RS04180 (879274) | 879274..879501 | + | 228 | WP_000164237.1 | helix-turn-helix transcriptional regulator | - |
P7F77_RS04185 (879498) | 879498..879644 | + | 147 | WP_000784893.1 | hypothetical protein | - |
P7F77_RS04190 (879637) | 879637..879846 | + | 210 | WP_001058487.1 | hypothetical protein | Antitoxin |
P7F77_RS04195 (879849) | 879849..880166 | + | 318 | WP_001103933.1 | DUF1474 family protein | Toxin |
P7F77_RS04200 (880233) | 880233..881102 | + | 870 | WP_001002695.1 | primase alpha helix C-terminal domain-containing protein | - |
P7F77_RS04205 (881119) | 881119..882588 | + | 1470 | WP_001668899.1 | virulence-associated E family protein | - |
P7F77_RS04210 (882874) | 882874..883236 | + | 363 | WP_001039169.1 | hypothetical protein | - |
P7F77_RS04215 (883238) | 883238..883522 | + | 285 | WP_000998179.1 | hypothetical protein | - |
P7F77_RS04220 (883519) | 883519..884160 | + | 642 | WP_063663413.1 | pathogenicity island protein | - |
P7F77_RS04225 (884610) | 884610..884951 | + | 342 | WP_001190615.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | hlb | 877115..941748 | 64633 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12511.13 Da Isoelectric Point: 4.6364
>T276062 WP_001103933.1 NZ_CP121204:879849-880166 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNELETKQEHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASSENFGEESDDAKKLKITE
MNWEIKDLMCDIEVIKEKINDVAIKHGWFVEDKFVKNELETKQEHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASSENFGEESDDAKKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K7ZRX2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0BJC0 |