Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
| Location | 780901..782038 | Replicon | chromosome |
| Accession | NZ_CP121201 | ||
| Organism | Streptococcus pluranimalium strain SP28 | ||
Toxin (Protein)
| Gene name | zeta | Uniprot ID | - |
| Locus tag | P7F70_RS04010 | Protein ID | WP_278025181.1 |
| Coordinates | 781175..782038 (+) | Length | 288 a.a. |
Antitoxin (Protein)
| Gene name | epsilon | Uniprot ID | R2XCR7 |
| Locus tag | P7F70_RS04005 | Protein ID | WP_000301765.1 |
| Coordinates | 780901..781173 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7F70_RS03965 (P7F70_03965) | 775947..776138 | + | 192 | WP_000503424.1 | hypothetical protein | - |
| P7F70_RS03970 (P7F70_03970) | 776192..777292 | + | 1101 | Protein_728 | recombinase family protein | - |
| P7F70_RS03975 (P7F70_03975) | 777442..778182 | + | 741 | WP_230340808.1 | hypothetical protein | - |
| P7F70_RS03980 (P7F70_03980) | 778203..778286 | + | 84 | WP_018451764.1 | 23S rRNA methyltransferase attenuation leader peptide | - |
| P7F70_RS03985 (P7F70_03985) | 778411..779148 | + | 738 | WP_002321849.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
| P7F70_RS03990 (P7F70_03990) | 779318..779578 | + | 261 | Protein_732 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
| P7F70_RS03995 (P7F70_03995) | 779681..780577 | + | 897 | WP_001809760.1 | ParA family protein | - |
| P7F70_RS04000 (P7F70_04000) | 780669..780884 | + | 216 | WP_002321610.1 | peptide-binding protein | - |
| P7F70_RS04005 (P7F70_04005) | 780901..781173 | + | 273 | WP_000301765.1 | antitoxin | Antitoxin |
| P7F70_RS04010 (P7F70_04010) | 781175..782038 | + | 864 | WP_278025181.1 | zeta toxin family protein | Toxin |
| P7F70_RS04015 (P7F70_04015) | 782479..782796 | + | 318 | WP_002338433.1 | hypothetical protein | - |
| P7F70_RS04020 (P7F70_04020) | 783008..783292 | + | 285 | WP_000922261.1 | hypothetical protein | - |
| P7F70_RS04025 (P7F70_04025) | 783299..785251 | + | 1953 | WP_000163792.1 | hypothetical protein | - |
| P7F70_RS04030 (P7F70_04030) | 785323..785820 | - | 498 | WP_000868795.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
| P7F70_RS04035 (P7F70_04035) | 786009..786689 | - | 681 | WP_278025182.1 | IS6-like element IS1216 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(O/W/32/O) / erm(B) / dfrG / ant(6)-Ia / lsa(E) / lnu(B) / aac(6')-aph(2'') / tet(L) / cat | - | 702088..827611 | 125523 | |
| - | inside | IScluster/Tn | dfrG / ant(6)-Ia / lsa(E) / lnu(B) / aac(6')-aph(2'') / tet(L) / cat | - | 785323..813297 | 27974 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32343.84 Da Isoelectric Point: 6.6610
>T276060 WP_278025181.1 NZ_CP121201:781175-782038 [Streptococcus pluranimalium]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGSVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAILEETQGSVIVIDNDTFKQQHPNFDELA
KLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGL
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3Q8X | |
| PDB | 1GVN | |
| AlphaFold DB | A0A829F0A3 |