Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4286011..4286606 | Replicon | chromosome |
| Accession | NZ_CP121199 | ||
| Organism | Escherichia coli strain E50 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | P6H83_RS20740 | Protein ID | WP_000239581.1 |
| Coordinates | 4286011..4286361 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | L4JJX7 |
| Locus tag | P6H83_RS20745 | Protein ID | WP_001223213.1 |
| Coordinates | 4286355..4286606 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H83_RS20720 (4281465) | 4281465..4282487 | - | 1023 | WP_001361374.1 | ABC transporter permease | - |
| P6H83_RS20725 (4282501) | 4282501..4284003 | - | 1503 | WP_001095661.1 | ATP-binding cassette domain-containing protein | - |
| P6H83_RS20730 (4284136) | 4284136..4285092 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| P6H83_RS20735 (4285402) | 4285402..4285932 | + | 531 | WP_000055072.1 | inorganic diphosphatase | - |
| P6H83_RS20740 (4286011) | 4286011..4286361 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| P6H83_RS20745 (4286355) | 4286355..4286606 | - | 252 | WP_001223213.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| P6H83_RS20750 (4286818) | 4286818..4287159 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| P6H83_RS20755 (4287162) | 4287162..4290941 | - | 3780 | WP_000060873.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T276053 WP_000239581.1 NZ_CP121199:c4286361-4286011 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|