Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3678325..3679162 | Replicon | chromosome |
Accession | NZ_CP121199 | ||
Organism | Escherichia coli strain E50 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A1M0D5U3 |
Locus tag | P6H83_RS17815 | Protein ID | WP_000227782.1 |
Coordinates | 3678620..3679162 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | B1LJI1 |
Locus tag | P6H83_RS17810 | Protein ID | WP_001353405.1 |
Coordinates | 3678325..3678636 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6H83_RS17785 (3673345) | 3673345..3674292 | + | 948 | WP_001239437.1 | cytochrome o ubiquinol oxidase subunit II | - |
P6H83_RS17790 (3674314) | 3674314..3676305 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
P6H83_RS17795 (3676295) | 3676295..3676909 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
P6H83_RS17800 (3676909) | 3676909..3677238 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
P6H83_RS17805 (3677250) | 3677250..3678140 | + | 891 | WP_000971327.1 | heme o synthase | - |
P6H83_RS17810 (3678325) | 3678325..3678636 | + | 312 | WP_001353405.1 | DUF1778 domain-containing protein | Antitoxin |
P6H83_RS17815 (3678620) | 3678620..3679162 | + | 543 | WP_000227782.1 | GNAT family N-acetyltransferase | Toxin |
P6H83_RS17820 (3679218) | 3679218..3680062 | - | 845 | Protein_3491 | tetratricopeptide repeat protein | - |
P6H83_RS17825 (3680469) | 3680469..3681833 | + | 1365 | WP_001000978.1 | MFS transporter | - |
P6H83_RS17830 (3681961) | 3681961..3682452 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
P6H83_RS17835 (3682620) | 3682620..3683531 | + | 912 | WP_000705841.1 | 2-dehydropantoate 2-reductase | - |
P6H83_RS17840 (3683494) | 3683494..3684084 | + | 591 | WP_001276320.1 | protein deglycase YajL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19957.31 Da Isoelectric Point: 9.1763
>T276050 WP_000227782.1 NZ_CP121199:3678620-3679162 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDIIYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCNFFEHVKIIHRALPIKGVYLDADPAAINFYTRLGFVQLSA
RPNVFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0D5U3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G7G3 |