Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 185309..185921 | Replicon | chromosome |
| Accession | NZ_CP121199 | ||
| Organism | Escherichia coli strain E50 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | U9YXE2 |
| Locus tag | P6H83_RS00840 | Protein ID | WP_000833473.1 |
| Coordinates | 185309..185494 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A1M2IVK0 |
| Locus tag | P6H83_RS00845 | Protein ID | WP_000499742.1 |
| Coordinates | 185511..185921 (+) | Length | 137 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6H83_RS00825 (180775) | 180775..182070 | + | 1296 | WP_000985745.1 | Fic family protein | - |
| P6H83_RS00830 (182178) | 182178..183716 | + | 1539 | WP_000183978.1 | aldehyde dehydrogenase AldB | - |
| P6H83_RS00835 (183757) | 183757..184836 | - | 1080 | WP_000061475.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
| P6H83_RS00840 (185309) | 185309..185494 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| P6H83_RS00845 (185511) | 185511..185921 | + | 411 | WP_000499742.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| P6H83_RS00850 (186033) | 186033..188012 | - | 1980 | WP_001026863.1 | glycoside hydrolase family 127 protein | - |
| P6H83_RS00855 (188023) | 188023..189423 | - | 1401 | WP_000204814.1 | MFS transporter | - |
| P6H83_RS00860 (189649) | 189649..190464 | + | 816 | WP_000891820.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T276034 WP_000833473.1 NZ_CP121199:185309-185494 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15242.13 Da Isoelectric Point: 4.4482
>AT276034 WP_000499742.1 NZ_CP121199:185511-185921 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMDEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | U9YXE2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2IVK0 |